KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_03014Help
Entry
XCAW_03014        CDS       T02519                                 

Gene name
bglX
Definition
(GenBank) Beta-glucosidase-related glycosidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
xci00520  Amino sugar and nucleotide sugar metabolism
xci01100  Metabolic pathways
xci01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:xci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XCAW_03014 (bglX)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    XCAW_03014 (bglX)
Enzymes [BR:xci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     XCAW_03014 (bglX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AGI08790
Position
complement(3357307..3358311)
Genome map
AA seq 334 aa AA seqDB search
MLLIGVAGTELSAQERDWLQHDAVAGVVLFKRNFASRTQVAELSAAIRAAAPRPVLICVD
QEGGRVQRFREGFSALAPLQSFGAQYAQDPEAALAAARAHAQLMASEVRASGVDLSFAPV
VDLGRGNRAIGDRAFSDEPQIVATFTRAYVQALHGAGMAATLKHFPGHGTVLEDTHVDHA
SDPRPLEVLQAEDLVPFVAGIEAGADAVMMAHVVYPQVAPEPAGYSQRWIEQILRGQMGF
RGVVFSDDIGMAASFSAGGVAGRVHAHLDAGCDVVLVCHPELVAESLQAVQGRSLNTAAL
IGLIGRGALGWDGLLAGTDASFTTPLSAHFGTTA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgatcggcgttgccggtaccgaactcagcgcacaggaacgcgattggctgcag
cacgatgcggttgccggcgtggtgctgttcaagcgcaacttcgcctcgcgcacccaggtg
gccgagctgtcggccgccattcgcgccgccgcgccgcgcccggtgctgatctgcgtggac
caggaaggtgggcgcgtgcagcggtttcgcgagggattcagcgcgctggcgccgttgcaa
agcttcggtgcgcaatacgcccaggacccggaggctgcactggccgccgcgcgcgcgcat
gcgcagttgatggccagcgaagtccgcgccagcggcgtggacctgagctttgcgccggtg
gtggacctgggccgcggcaaccgggccattggcgatcgcgccttcagcgatgagccgcag
atcgtggccaccttcacgcgcgcctatgtacaggcgctgcatggggccggcatggccgcc
acgctcaagcatttccccggccacggcaccgtgctggaagacacccatgtcgaccacgcc
agcgacccgcggccgctggaggtgctgcaggccgaagacctggtgccgttcgtggcgggg
atcgaggccggcgccgacgccgtgatgatggcgcacgtggtctacccgcaggtcgccccg
gagccggccggctattcgcagcgctggatcgagcagatcctgcgcggccagatgggcttc
cgcggcgtggtcttttccgacgacatcggcatggccgcctcgttcagtgccggcggggtg
gcgggtcgtgtgcatgcgcatctggatgccggctgcgacgtggtgctggtgtgccacccg
gaactggtcgccgaatcgctgcaggccgtgcagggccgcagcctcaataccgccgcattg
atcggcctgatcggccgcggcgcactaggttgggatggcctgctcgccggcaccgatgcc
tcatttaccactcctctttctgcccatttcggaacaactgcctga

DBGET integrated database retrieval system