KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_03718Help
Entry
XCAW_03718        CDS       T02519                                 

Gene name
apaG
Definition
(GenBank) Uncharacterized protein affecting Mg2+/Co2+ transport
  KO
K06195  ApaG protein
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Brite
KEGG Orthology (KO) [BR:xci00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    XCAW_03718 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AGI09483
Structure
PDB: 

Position
4144673..4145056
Genome map
AA seq 127 aa AA seqDB search
MQDDPRYRVEVEVSPRFLAHQSTPDEGRYAFAYSIRIQNAGAVPARLVARHWQITDGNGR
TEQVDGEGVVGEQPWLRPGEAFHYTSGVLLETEQGQMQGHYDMVADDGTEFIAPIAAFVL
SVPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatgatccgcgctaccgggtcgaggtcgaggtatcgccccgcttcctcgcccat
caatccaccccggacgaaggccgctatgcctttgcctacagcatccgcatccagaatgcg
ggcgcggtgcctgcgcgcctggtcgcgcgccattggcagatcaccgatggcaacggacgc
accgagcaggtggatggcgaaggggtggtcggcgaacagccgtggctgcgcccgggcgaa
gcgttccattacacctctggcgtactgctggagaccgagcagggacagatgcaaggccac
tacgacatggtggccgacgatggcaccgaatttatcgccccgatcgccgccttcgtgctg
agcgtgcccaggacgctgcactga

DBGET integrated database retrieval system