KEGG   Xanthomonas citri subsp. citri UI6: J158_00328Help
Entry
J158_00328        CDS       T03894                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xcj  Xanthomonas citri subsp. citri UI6
Pathway
xcj00071  Fatty acid degradation
xcj00072  Synthesis and degradation of ketone bodies
xcj00280  Valine, leucine and isoleucine degradation
xcj00310  Lysine degradation
xcj00362  Benzoate degradation
xcj00380  Tryptophan metabolism
xcj00620  Pyruvate metabolism
xcj00630  Glyoxylate and dicarboxylate metabolism
xcj00640  Propanoate metabolism
xcj00650  Butanoate metabolism
xcj00900  Terpenoid backbone biosynthesis
xcj01100  Metabolic pathways
xcj01110  Biosynthesis of secondary metabolites
xcj01120  Microbial metabolism in diverse environments
xcj01130  Biosynthesis of antibiotics
xcj01200  Carbon metabolism
xcj01212  Fatty acid metabolism
xcj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    J158_00328
   00630 Glyoxylate and dicarboxylate metabolism
    J158_00328
   00640 Propanoate metabolism
    J158_00328
   00650 Butanoate metabolism
    J158_00328
  09103 Lipid metabolism
   00071 Fatty acid degradation
    J158_00328
   00072 Synthesis and degradation of ketone bodies
    J158_00328
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    J158_00328
   00310 Lysine degradation
    J158_00328
   00380 Tryptophan metabolism
    J158_00328
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    J158_00328
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    J158_00328
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    J158_00328
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcj04147]
    J158_00328
Enzymes [BR:xcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     J158_00328
Exosome [BR:xcj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   J158_00328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJY84759
Position
260733..262013
Genome map
AA seq 426 aa AA seqDB search
MPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVAMGAVI
KHSADWNLAREAALSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIGGGSDT
TSEVPIVYGKKLRARLLAANRAKATGDKLRALLRGFKLAELKPEFPGVAEPRTGKSMGDH
CEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDALIAPFRGVSRDNILRADTSLEKL
ATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSSEAWALAHGHTPMAYLRDAQVAAVDF
VHGEGLLMAPTIAVPQMLARQGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCRNRLGL
DAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTAGGMGV
VAIVER
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcagcccgtcccgtcgccattctgggcggcgttcgtatcccgttctgtcgtcag
aacaccgcctacgcggacgtgggcaacctgggcatgtcggtgcgcacgctgggcgcgttg
gtcgagcgcttcgggttgcatgggcagcaattgggcgaagtggcgatgggcgcggtgatc
aagcactccgcggactggaacctggcgcgcgaggcggcgctgtcgtcgggtctgtcgccg
ctgacgccgggcatcaccctgcagcgcgcctgcggcaccagcctggattcggtcatcacc
atcgccaacaagatcgcgctggggcagatcgactcgggcatcggcggcggctccgacacc
acctccgaagtgccgatcgtgtacggcaagaagttgcgcgcacggctgctggccgccaac
cgcgccaaggccaccggcgacaagctcagggcgctgctgcgcggcttcaagctggccgag
ctcaagcccgaattccccggcgtggccgagccgcgcaccggcaagagcatgggcgaccat
tgcgaggacatggccaaggaatggaacatctcgcgcgattcgcaggacgaatgggcggtg
gcctcgcaccacaagctggccgctgcctatgagcgcggtttcttcgacgcgctgatcgcg
ccgttccgcggcgtctcgcgcgacaacatcctgcgcgccgacacctcgctggaaaaactc
gcgaccttgcgaccggccttcgacaagacctccggccgtggcacgttgaccgctgccaat
tccaccccgctcaccgatggcgccgccgcggtgctgctctccagcgaagcctgggcgttg
gcgcatggccacacgccgatggcctacctgcgcgatgcacaggtggcggcagtcgacttc
gtgcatggcgaaggcctgctgatggcgcccaccattgcggtgccgcagatgctggcgcgc
cagggcctgaccctgcaggacttcgatatctacgaaatccacgaggccttcgccgcgcag
gtgctgtgcacgctgcgcgcgtgggagagcgaggactactgccgcaaccggctgggcctg
gacgcgccgctgggccgcatcgacccggacaagatcaatccgctgggctcgtcgctggcc
accggccatccattcgccgccactggcgcacgcgtggtggccaccgctgccaagcagttg
gaagagcgcggcggcggccgcgcgttgatttcgatctgcaccgccggcggcatgggcgtg
gtggccatcgtcgagcgctga

DBGET integrated database retrieval system