KEGG   Xanthomonas citri subsp. citri UI6: J158_00360Help
Entry
J158_00360        CDS       T03894                                 

Definition
(GenBank) Pseudouridylate synthase, 23S RNA-specific
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
xcj  Xanthomonas citri subsp. citri UI6
Brite
KEGG Orthology (KO) [BR:xcj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xcj03016]
    J158_00360
Enzymes [BR:xcj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     J158_00360
Transfer RNA biogenesis [BR:xcj03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    J158_00360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AJY84791
Position
292046..292780
Genome map
AA seq 244 aa AA seqDB search
MSISPKHLQILYQDDVLAVVDKPAGLMVHDSKLARGEDDFLADRLREQLGKPIFLVHRLD
RATSGCLLLAFDRDSASALGKALMAGEVEKQYLTVCRGWPAEERFIVDHDLDGGPGKPVK
KPAVTHFQRLATGELEIPSTGFTTSRYALLRCQPQTGRFRQIRRHMKHLSHHMIGDTSHG
DGRHNRSFRMLGIHRMLLHAERLEFPHPADGRRIGVTAPLDVEFSKACALFGWEMAGLGV
MQTA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatatcccccaaacatctgcagattctctaccaggacgatgtcctggccgtcgtc
gacaaacccgccggcctgatggtccatgacagcaagctggcgcgtggagaggacgacttc
ctggccgaccgcctgcgcgagcagctgggcaagccgatctttttggtgcaccggctcgac
cgcgccaccagcggctgcctgctgttggccttcgatcgcgacagcgccagtgcgctgggc
aaggctttgatggccggcgaggtggagaaacagtatctgaccgtctgtcgcggctggccg
gccgaggagcgcttcatcgtcgaccatgacctggacggcggtccgggcaagccggtcaag
aagccggcagtgacgcatttccagcgtctggccaccggcgagctggagattccttccacc
gggttcaccacctcgcgctacgcactgctgcgctgtcagccgcaaaccggccgcttccgg
cagattcgccggcatatgaagcatctgtcgcatcacatgatcggcgacaccagccacggc
gacggccgccacaaccgcagtttccgcatgctcggcatccaccgcatgttgctgcacgcc
gaacgcctggaatttccgcatccggccgatggcaggcgcatcggcgtcaccgcgccgctg
gatgtcgaattttccaaggcctgcgcgttgtttgggtgggagatggcggggttgggagtc
atgcagacggcgtga

DBGET integrated database retrieval system