KEGG   Xanthomonas citri subsp. citri UI6: J158_00870Help
Entry
J158_00870        CDS       T03894                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
xcj  Xanthomonas citri subsp. citri UI6
Pathway
xcj00740  Riboflavin metabolism
xcj00790  Folate biosynthesis
xcj01100  Metabolic pathways
xcj01110  Biosynthesis of secondary metabolites
Module
xcj_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:xcj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    J158_00870
   00790 Folate biosynthesis
    J158_00870
Enzymes [BR:xcj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     J158_00870
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     J158_00870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AJY85297
Position
889047..890186
Genome map
AA seq 379 aa AA seqDB search
MNFAPVPELIEELRAGRMVVIVDDEDRENEGDLIMAAELVKPSDINFMVTHARGLVCLSL
TRERCAQLGLAPMVRNNTAQFQTNFTVSIEAAEGVTTGISAYDRAHTVRTAVRPDARPQD
LSQPGHIFPLISQPGGVLTRAGHTEAASDLPMLAGLEPAGVLVEVLNPDGSMARRPQLEV
FAREHGLKMGSIADLIAYRLANEHTVERVDEREITTEFGPFKLVTYRDRIAHDLHFALLR
GRADPQTPTLVRVQVENPLADLLHWQRDDFGVAATDALRAIAAEGQGVMVVLSAPRDSES
LLARLRQQPEAAANAKDVSQWRRNGAGAQILADLGLGKLRVLGTPRRQVGLAGFGLEVVE
YLECHAGEGVRSVPPSAVP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgcgcccgttccggaactgatcgaagaactgcgcgccggacgcatggtggtc
atcgtcgatgacgaagaccgcgaaaacgaaggcgatctgatcatggccgccgagttggtg
aagccgtcggacatcaacttcatggtcacccacgcgcgcgggctggtgtgcctgtcgctg
acccgcgagcgctgcgcgcagctgggtctggcgccgatggtgcgcaacaacaccgcgcag
ttccagaccaacttcactgtcagcatcgaagcggccgaaggggtgaccaccggcatttcg
gcctacgaccgcgcgcacaccgtgcgcaccgcagtccgcccggatgcccggccacaggat
ttgagccagcccgggcatatcttcccgttgatctcccagcccggtggcgtgctgacccgt
gccggccacaccgaagcggccagcgatctgccgatgctggccggactggaaccggccggt
gtgctggtggaagtgctcaacccggacggcagcatggcgcgtcgcccgcagctggaagtg
ttcgcgcgcgagcatgggctgaagatgggctcgatcgccgacctgatcgcatatcggctt
gccaatgagcacaccgtcgagcgcgtggacgagcgcgagatcaccaccgaattcggtccg
ttcaagctggtgacctaccgcgaccgcatcgcgcacgacctgcactttgcgctgttgcgc
gggcgcgccgatccgcagacgccgacgctggtgcgcgtacaggtggaaaacccattggcc
gacctgctgcactggcagcgcgatgacttcggcgtggcagccactgatgccttgcgcgcg
atcgccgccgaggggcagggcgtgatggtggtgctgtcggcgccacgcgacagcgaatcg
ctgctggcacggctgcgccagcagcccgaagccgccgccaatgccaaggacgtgagtcag
tggcggcgcaacggcgccggtgcgcagatcctggccgacctcggcctgggcaagttgcgc
gtgctgggcaccccccggcgccaggtggggttggccggattcgggctggaggtggtcgag
tatttggagtgccatgccggtgaaggcgtgcgctcggtgccgccgtctgccgttccctga

DBGET integrated database retrieval system