KEGG   Xanthomonas citri subsp. citri UI6: J158_01101Help
Entry
J158_01101        CDS       T03894                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
xcj  Xanthomonas citri subsp. citri UI6
Pathway
xcj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:xcj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    J158_01101
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:xcj03011]
    J158_01101
Ribosome [BR:xcj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    J158_01101
  Bacteria
    J158_01101
  Archaea
    J158_01101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AJY85521
Position
1138130..1138465
Genome map
AA seq 111 aa AA seqDB search
MEAKAILRTARISPQKARLVADQVRGLSAERAVNLLKFSDKKAAHLIKKVVESAIANAEN
NQGADVDELKVKTIMVDEGPSLKRFMARAKGRGTRILKRTSHITVVVGAAK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgaaagcaatcctgcgcaccgcgcgcatctccccgcagaaggcccgcctggtc
gctgaccaggtgcgtggtttgtccgccgagcgtgcggtcaatctgctgaagttctcggac
aagaaggctgcacacctgatcaaaaaggtggtggagtcggcgatcgccaatgccgagaac
aatcagggcgcggatgtcgacgagctgaaggtcaagaccatcatggttgatgaaggtccc
tccctgaagcgtttcatggcgcgggcgaaaggccgcggtacccgcatcctcaagcgcacc
agccacatcactgtggttgtgggcgccgccaagtaa

DBGET integrated database retrieval system