KEGG   Xanthomonas citri subsp. citri UI6: J158_01126Help
Entry
J158_01126        CDS       T03894                                 

Definition
(GenBank) Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit
  KO
K01426  amidase [EC:3.5.1.4]
Organism
xcj  Xanthomonas citri subsp. citri UI6
Pathway
xcj00330  Arginine and proline metabolism
xcj00360  Phenylalanine metabolism
xcj00380  Tryptophan metabolism
xcj00627  Aminobenzoate degradation
xcj00643  Styrene degradation
xcj01100  Metabolic pathways
xcj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    J158_01126
   00360 Phenylalanine metabolism
    J158_01126
   00380 Tryptophan metabolism
    J158_01126
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    J158_01126
   00643 Styrene degradation
    J158_01126
Enzymes [BR:xcj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     J158_01126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Pilus_CpaD
Motif
Other DBs
NCBI-ProteinID: AJY85546
Position
complement(1155973..1157637)
Genome map
AA seq 554 aa AA seqDB search
MRFTLLSFALLAALCGCAHADDPSRSATGTADASTAHPIDLSEADVAGLQARMASGQSSS
LQLTRAYLQRIASIDRAGPRLNAVVELNPQAEADARALDAERKAGHVRGPLHGIPVLLKD
NIDALPMVNSAGSLALAEFRPDRDAFVVQRLRAAGAVILGKTNLSEWANFRSTQSSSGWS
GRGGLTRNPYALDRNPCGSSAGTGAAIAASLATVGIGTETDGSITCPASVSGLVGLKPTV
GLVSRDGIIPISTSQDTAGPMTRSVADAAAVLQAIAAPDPQDPATARAPATSVDYLAHLK
PDSLRGARLGLLRNPLREDPAIATALDRAVQTLRAAGATVVETALVTDGKWDAAEQMVLL
VEFKAGLNAYLQNHHTPVATLQQLIAFNRNHAQREMPYFGQELFEQAQAAPGLDDAGYLS
ARANAKRLAGPEGIDAALKADRLDALIVPTTGAAWVTTLGKGDTFPGAGYGAAAVAGYPS
LSVPMGQTQGLPLGLLFMGTAWSEPRLIELAYAYEQRSHARFTPGYAPSAPAAPGPATSG
TTPVAPAQGSRQHD
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgcgattcacccttttgtccttcgcgctgcttgccgcgctgtgcggctgtgcgcatgcc
gatgatccatcgcgttctgcgaccggcactgccgacgcgtccaccgcccaccctatcgat
ctgagcgaggccgacgtggccggcctgcaggcgcgcatggccagcggccagagcagcagc
ctgcaactgacgcgcgcgtatctgcagcgtattgccagcatcgatcgcgccggccccagg
ctcaacgcggtggtcgaactcaatccgcaggccgaagccgacgcccgcgccctggacgcc
gaacgcaaagccggccacgtgcgtgggccgctgcacgggatcccggtgctgctcaaggac
aatatcgacgcgctgccgatggtcaacagcgccggctcgctggcgctggccgagttccgt
cccgaccgcgacgcgtttgtggtgcagcgcctgcgcgctgccggtgcggtgatcctgggc
aagaccaacctcagcgaatgggccaatttccgctccacccaatccagctccggctggagc
ggacgcggggggctcacgcgcaatccgtatgcgctggatcgtaatccctgcggctccagt
gccggcaccggtgcggccatcgcggccagcctggctaccgtcggcatcggtaccgaaacc
gatggcagcattacctgtccggcatcggtcagcggcctggtcgggctcaagccgaccgtt
ggcctggtcagtcgcgacggcatcatcccgatttccaccagccaggacaccgccggcccg
atgacccgcagcgtcgccgatgcggctgcagtgctgcaggccatcgccgcacccgacccg
caggacccggccaccgccagggcaccggcgaccagcgtcgattatctcgcccacctgaaa
cccgacagcctgcgtggcgcgcgcctgggcctgttgcgcaacccgctccgcgaggacccg
gcgatcgccacggcgctcgaccgcgccgtgcagacgctgcgtgcagcaggcgctactgtg
gtcgagaccgccctggtcaccgatggcaagtgggacgcagccgagcagatggtcttattg
gtcgaattcaaggccggcttgaatgcgtatctgcaaaaccaccacacgcccgtggcgacc
ctgcagcagttgattgcgttcaatcgcaaccatgcgcagcgcgagatgccgtacttcggg
caggagctgttcgaacaggcgcaggcagcgcccggtctcgatgatgcggggtatctgagc
gcgcgcgccaacgccaagcggttggccgggccggaaggcatcgacgcagccttgaaggca
gatcgcctggatgccttgatcgtgcccaccaccggcgcggcgtgggtcaccacgctcggc
aagggcgataccttccccggcgccggctatggtgccgctgcagtggccggctatccaagc
ctgagcgtgccgatgggacagacccagggcttgccacttggcctgttgttcatgggcacg
gcctggagcgagccgcgcctgatcgagctggcgtatgcgtacgaacaacgcagccatgcg
cgctttacgcctggctatgcgcccagtgcgccggctgcgccaggtccggcaacgtcaggc
acgacacccgtcgcgccggcgcaggggtcgcgccagcatgattga

DBGET integrated database retrieval system