KEGG   Xanthomonas citri subsp. citri UI6: J158_03503Help
Entry
J158_03503        CDS       T03894                                 

Definition
(GenBank) uroporphyrinogen-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
xcj  Xanthomonas citri subsp. citri UI6
Pathway
xcj00860  Porphyrin and chlorophyll metabolism
xcj01100  Metabolic pathways
xcj01110  Biosynthesis of secondary metabolites
xcj01120  Microbial metabolism in diverse environments
Module
xcj_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:xcj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    J158_03503
Enzymes [BR:xcj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     J158_03503
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     J158_03503
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     J158_03503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 Yop-YscD_cpl
Motif
Other DBs
NCBI-ProteinID: AJY87870
Position
3911118..3912320
Genome map
AA seq 400 aa AA seqDB search
MTPAFPLLADLRGRAVLVVGGGADAERATGQLLQAGALPLVGAPELTAQLRHWAQAGRLR
WLAGRFDPAWLAQSDQPLWLTIAASESAALNDALRQAASAHRLLTHAAAPAASATVPARS
TGPRSAIGTLAPGNVSLVGAGPGDPGLPTRHALRALRQAEVVLHDRLVSPQILRLARHGA
HLIEVGKSAQGHSTRQEQIHGLMLEHARAGRRVVRLKGGDPFVFGRGGEELEFLRAHGIG
FQVIPGITAAIACAAYAGIPLTHRDHAQSLRLITAHCKDSLDTLDWQALGQERQTLAFYM
GVAGLDAIQQRLLQAGRAPTTPFALVENGSRPQQRVITGTLASLAASARQHAVTAPALLI
LGEVTALAQTLHWFGSAPLSASPPHSPGATPHTPTLAHAA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtgactcctgcgttcccgctgcttgccgacctgcgtggccgtgccgtcctggtggtcggc
ggcggcgccgacgccgagcgcgccactggccagttgctgcaggccggtgcgctgccgctg
gtcggcgcgcccgagctcacggcgcagttgcggcactgggcgcaggcaggccggctgcgc
tggttggccggtcggttcgacccggcatggctggcgcagtccgaccaaccgctatggctc
accatcgccgccagcgaatcggcagcgctcaacgacgccctgcgccaagcagcaagtgcc
catcggctgctgacccacgccgcagcgcctgcggcgtccgcaacggttcctgcgcgctcc
acaggaccgcgcagcgcgatcggcacgctggcgcccggcaacgtgagcctggtcggcgcc
ggccccggcgatccgggcctgcccacacggcatgcgctgcgcgcactgcgtcaggccgag
gtggtgctgcacgaccgcctggtcagcccgcagatcctgcgcctggctcggcacggcgcg
cacctcatcgaggtcggcaagtcggcgcaaggccatagcacccggcaggaacagattcac
ggcctgatgctggaacacgcccgggccggtcgccgcgtggtacggctgaagggcggcgac
ccattcgtgttcggccgcggcggcgaagagctggaattcctgcgcgcgcacggcatcggc
ttccaggtgattcccggcatcaccgccgccatcgcctgcgccgcctatgccggcattccg
ctcacccaccgcgaccatgcgcaatcgctgcggctgatcaccgcgcactgcaaggattcg
ctggacacgctggattggcaggcgcttggccaggaacgccagaccctggcgttctacatg
ggcgtggccggtctggacgccatccagcaacgtctgctgcaggccggccgcgcacccacc
accccgttcgcgctggtcgaaaacggctcgcgcccgcagcaacgggtaatcaccggtacg
ctcgccagcctggccgccagcgcccggcagcacgccgtgaccgcaccggcgctgctgatc
ctgggcgaggtaacggcactggcgcagacgctgcattggttcggcagcgcgccgctgagc
gcctcgccgccgcactcacccggcgcaacgccccacacgcccacactggcccacgcagcc
tga

DBGET integrated database retrieval system