KEGG   Xanthomonas citri pv. citri MN12: J164_00327Help
Entry
J164_00327        CDS       T03735                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xcm  Xanthomonas citri pv. citri MN12
Pathway
xcm00071  Fatty acid degradation
xcm00072  Synthesis and degradation of ketone bodies
xcm00280  Valine, leucine and isoleucine degradation
xcm00310  Lysine degradation
xcm00362  Benzoate degradation
xcm00380  Tryptophan metabolism
xcm00620  Pyruvate metabolism
xcm00630  Glyoxylate and dicarboxylate metabolism
xcm00640  Propanoate metabolism
xcm00650  Butanoate metabolism
xcm00900  Terpenoid backbone biosynthesis
xcm01100  Metabolic pathways
xcm01110  Biosynthesis of secondary metabolites
xcm01120  Microbial metabolism in diverse environments
xcm01130  Biosynthesis of antibiotics
xcm01200  Carbon metabolism
xcm01212  Fatty acid metabolism
xcm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    J164_00327
   00630 Glyoxylate and dicarboxylate metabolism
    J164_00327
   00640 Propanoate metabolism
    J164_00327
   00650 Butanoate metabolism
    J164_00327
  09103 Lipid metabolism
   00071 Fatty acid degradation
    J164_00327
   00072 Synthesis and degradation of ketone bodies
    J164_00327
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    J164_00327
   00310 Lysine degradation
    J164_00327
   00380 Tryptophan metabolism
    J164_00327
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    J164_00327
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    J164_00327
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    J164_00327
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcm04147]
    J164_00327
Enzymes [BR:xcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     J164_00327
Exosome [BR:xcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   J164_00327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJY93653
Position
260733..262013
Genome map
AA seq 426 aa AA seqDB search
MPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVAMGAVI
KHSADWNLAREAALSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIGGGSDT
TSEVPIVYGKKLRARLLAANRAKATGDKLRALLRGFKLAELKPEFPGVAEPRTGKSMGDH
CEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDALIAPFRGVSRDNILRADTSLEKL
ATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSSEAWALAHGHTPMAYLRDAQVAAVDF
VHGEGLLMAPTIAVPQMLARQGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCRNRLGL
DAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTAGGMGV
VAIVER
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcagcccgtcccgtcgccattctgggcggcgttcgtatcccgttctgtcgtcag
aacaccgcctacgcggacgtgggcaacctgggcatgtcggtgcgcacgctgggcgcgttg
gtcgagcgcttcgggttgcatgggcagcaattgggcgaagtggcgatgggcgcggtgatc
aagcactccgcggactggaacctggcgcgcgaggcggcgctgtcgtcgggtctgtcgccg
ctgacgccgggcatcaccctgcagcgcgcctgcggcaccagcctggattcggtcatcacc
atcgccaacaagatcgcgctggggcagatcgactcgggcatcggcggcggctccgacacc
acctccgaagtgccgatcgtgtacggcaagaagttgcgcgcacggctgctggccgccaac
cgcgccaaggccaccggcgacaagctcagggcgctgctgcgcggcttcaagctggccgag
ctcaagcccgaattccccggcgtggccgagccgcgcaccggcaagagcatgggcgaccat
tgcgaggacatggccaaggaatggaacatctcgcgcgattcgcaggacgaatgggcggtg
gcctcgcaccacaagctggccgctgcctatgagcgcggtttcttcgacgcgctgatcgcg
ccgttccgcggcgtctcgcgcgacaacatcctgcgcgccgacacctcgctggaaaaactc
gcgaccttgcgaccggccttcgacaagacctccggccgtggcacgttgaccgctgccaat
tccaccccgctcaccgatggcgccgccgcggtgctgctctccagcgaagcctgggcgttg
gcgcatggccacacgccgatggcctacctgcgcgatgcacaggtggcggcagtcgacttc
gtgcatggcgaaggcctgctgatggcgcccaccattgcggtgccgcagatgctggcgcgc
cagggcctgaccctgcaggacttcgatatctacgaaatccacgaggccttcgccgcgcag
gtgctgtgcacgctgcgcgcgtgggagagcgaggactactgccgcaaccggctgggcctg
gacgcgccgctgggccgcatcgacccggacaagatcaatccgctgggctcgtcgctggcc
accggccatccattcgccgccactggcgcacgcgtggtggccaccgctgccaagcagttg
gaagagcgcggcggcggccgcgcgttgatttcgatctgcaccgccggcggcatgggcgtg
gtggccatcgtcgagcgctga

DBGET integrated database retrieval system