KEGG   Xanthomonas citri pv. citri MN12: J164_01269Help
Entry
J164_01269        CDS       T03735                                 

Definition
(GenBank) aconitase
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
xcm  Xanthomonas citri pv. citri MN12
Pathway
xcm00640  Propanoate metabolism
xcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    J164_01269
Enzymes [BR:xcm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     J164_01269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AJY94572
UniProt: A0A0U5FAT8
Position
1289146..1291737
Genome map
AA seq 863 aa AA seqDB search
MNSQYRKPLPGTSLDYFDARAAVDALQPGAYATLPYTARVHAENLVRRAEPQLLEAYLRQ
LIERKRELDFPWFPARVVCHDILGQTALVDLAGLRDAIAEQGGDPAQVNPVVPVQLIVDH
SLAVEYAGFDKQAFAKNRSVEDRRNADRFHFIEWTKRAFENMEVIPPGNGIMHQINLEKM
SPVIYTLDGVAFPDTCVGTDSHTPHVDALGVIAVGVGGLEAENVMLGRASWMRLPDIIGV
ELTGRPAPGITATDIVLALTEFLRAQRVVGAYLEFYGDGARALTIGDRATISNMTPEFGA
TAAMFSIDQQTIDYLRLTGRDDAQVALVETYARHTGLWADDLATAQYERVLQFDLASVVR
NMAGPSNPHKRVATTALADRGIAGAWEQVPGKMPDGAVIIAAITSCTNTSNPRNVIAAGL
LARNANARGLTRKPWVKSSLAPGSKAVQLYLEEAGLLSELEQLGFGIVAFACTTCNGMSG
ALDPAIQQEVIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVIAYAIAGTVRFDIE
KDVLGIDADGVPVTLKDLWPSDAEIDAVVARSVKPEHFRSVYDPMFKRSAGQGISVNPLY
EWRPASTYIRRPPYWEGALAGARTLLGMRPLAVLGDNITTDHLSPSNAIMAGSAAGQYLA
QMGVPEEDFNSYATHRGDHLTAQRATFANPKLINEMAVVDGQIKAGSLARLEPEGQVLRM
WEAIETYMTRKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEVIVAEGFERIHRTNLIGMG
VLPLEFKPGTDRRTLGIDGSETFDVVGERTPGATLTLSIHRRDGEQLQVPVTCRLDTAEE
VSIYEAGGVLQRFAQDFLEASAA
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgaatagccagtaccgcaagcccttgccgggcacctcgttggattacttcgatgcacgc
gctgccgtcgatgcgctgcagcccggtgcgtatgcgaccttgccgtacaccgcacgcgtg
catgccgagaacctggtgcggcgtgcagagccgcaactgctggaggcgtacctgcggcag
ttgatcgagcgcaagcgcgagctggatttcccgtggtttccggcacgtgtggtgtgtcac
gacatcctgggccagaccgcattggtcgatcttgccggcttgcgcgatgccattgccgag
cagggcggcgacccggcacaagtcaatccggtggtgccggtgcagttgatcgtggatcac
tcgctggcagtggaatacgccggcttcgacaagcaggcgttcgccaagaatcgcagcgtg
gaagatcgccgcaacgccgatcgcttccacttcatcgaatggaccaagcgtgcgttcgag
aacatggaagtgattccgccaggcaacgggatcatgcatcagatcaatctggagaagatg
tcgccagtgatctacacgctcgatggcgtggcgttcccggatacctgtgtgggcaccgac
agccacacgccgcatgtggatgcgctgggcgtgatcgcggtgggcgtcggcgggttggaa
gcggagaacgtgatgctgggccgcgcctcgtggatgcgcctgccggacatcatcggcgtg
gaattgaccggccggccggcgcctggcatcaccgccaccgacatcgtgctggcattgacc
gaattcctgcgcgcgcaacgcgtggttggggcgtatctcgagttttacggggatggtgcg
cgggcgctgaccatcggcgaccgcgcgaccatttccaacatgacgccggaattcggtgcg
acggcggcgatgttctctatcgaccagcagaccatcgactacctgcggctcactggtcgc
gacgatgcgcaggtcgcattggtggagacctatgcgcggcataccggcctatgggcagac
gatctggccaccgcgcagtacgagcgcgtgctgcagttcgatctggcgagcgtggtgcgc
aacatggccgggccgtccaatccgcacaaacgcgtggccaccaccgcactggcggatcgt
ggcattgccggtgcgtgggagcaggtgccggggaagatgcccgatggcgcagtaatcatc
gcagcgatcacctcgtgcaccaatacctcgaacccgcgcaacgtgattgctgccggtttg
ctggcgcgcaatgccaatgcgcgtggcttgacccgcaagccgtgggtgaaaagctcgctg
gctccgggatccaaggcagtgcaactgtacctggaagaagccgggttactgagcgagctg
gaacaattgggcttcggcatcgtggcgtttgcctgcaccacctgcaatggcatgagcggg
gcgctggatcctgcgatccagcaggaagtcatcgatcgcgatctgtatgccacggcggtg
ctgtcgggcaaccggaatttcgatgggcgcatccatccgtatgccaagcaggcgtttctt
gcttcgccgccgctggtgattgcctatgccattgccggcaccgtgcgcttcgatatcgag
aaggatgtgttgggcatcgacgccgacggcgtgccggtcacgctcaaggatctgtggccg
agcgatgccgagatcgacgcagtggtggcgcgcagcgtcaagccggaacacttccgcagc
gtgtacgacccgatgttcaagcgcagcgcggggcaggggatcagcgtgaacccgttgtac
gagtggcgcccggccagcacgtatattcggcgcccgccgtactgggaaggcgccttggcc
ggcgcgcgcacgctgctcggcatgcgcccgttggccgtgctgggcgacaacatcaccacc
gatcacctgtcgccgtcgaacgcgatcatggccggcagtgccgccgggcaatatctggcg
caaatgggcgtgccggaggaggacttcaattcctacgccacccatcgcggcgaccacctc
accgcccagcgtgcgacgtttgccaaccccaagttgatcaacgaaatggcggtggtcgat
gggcagatcaaagccggctcgctggcccggctggagccggagggccaggtgctacgcatg
tgggaggcgatcgaaacctatatgacgcgcaagcagccgttgatcatcattgccggcgcc
gattacgggcagggctcgtcgcgcgactgggcagccaagggtgtgcggcttgccggtgtg
gaagtgattgtcgccgaaggcttcgagcggattcaccgtaccaacttgatcggcatgggc
gtgctgccgctggagttcaagccgggcaccgaccgcaggaccttgggcatcgatggcagc
gaaactttcgacgtggtgggtgagcgcacgccgggcgccacgctgacgttgtcgatccat
cggcgtgatggcgagcagctgcaggtgccggtgacctgccgactggatactgcagaggaa
gtgtcgatttacgaagccggtggcgtgttgcagcggtttgcgcaggattttctggaagcc
tcggctgcctga

DBGET integrated database retrieval system