KEGG   Xanthomonas citri pv. citri MN12: J164_01528Help
Entry
J164_01528        CDS       T03735                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
xcm  Xanthomonas citri pv. citri MN12
Pathway
xcm00450  Selenocompound metabolism
xcm00970  Aminoacyl-tRNA biosynthesis
xcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    J164_01528
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    J164_01528
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xcm01007]
    J164_01528
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xcm03016]
    J164_01528
Enzymes [BR:xcm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     J164_01528
Amino acid related enzymes [BR:xcm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   J164_01528
Transfer RNA biogenesis [BR:xcm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    J164_01528
 Prokaryotic type
   Other AARSs
    J164_01528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AJY94828
UniProt: A0A0U5FB91
Position
complement(1592377..1594461)
Genome map
AA seq 694 aa AA seqDB search
MTRTALVTTALPYANGPLHLGHLVGYIQADIWVRARRLRGDKTWFVCADDTHGTPIMLAA
EKAGVTPEAFIANVQASHERDFAAFGVTFDHYDSTNSPVNRELTEAFYAKLEAAGHISRR
SVAQFYDTAKGMFLPDRYIKGICPNCGSPDQYGDNCEVCGATYAPTELKEPKSVISGATP
ELRDSEHFFFEVGHFDGFLREWLAGDVALPGVKAKLKEWLDAEGGLRAWDISRDAPYFGF
QIPGQPGKYFYVWLDAPIGYLCSFKTLCAQMGENFEAHLVAGTQTELHHFIGKDIVNFHG
LFWPAVLHGTGHRAPTRLHVNGYLTVDGAKMSKSRGTFVMARTFLDVGLEPEALRYYFAA
KSSGGVDDLDLNLGDFIARVNADLVGKFVNLASRCAGFIGKRFDGKLADALPDAAQYDRF
VAALAPIREAYERNDAASAIRQTMALADEANKYIDDTKPWVIAKQDGADAQLQSVCTQGL
NLFRILVAALKPILPRTCAEAEAFLSAPMTSWEDVIGPLTAHTIQPYTALFTRIDPKLID
AMTDASKDTLAAPATPATASKPAPAKADAKPAAAANPQSPIATPGFIGMDDFAKLDLRIG
KVLACEFVEGSDKLLRFELDAGELGTRQIFSGIRASYREPETLVGRSVVFIANLAPRKMR
FGISEGMILSAGFDGGALALLDADSGAQPGMPVR
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaccgcactcgtcaccactgccctgccgtatgccaacggcccgctgcatctc
ggccacttggtcggctacatccaggccgatatctgggtgcgcgcgcgccggttgcgcggc
gacaagacctggttcgtctgtgccgacgacacccatggcacgccgatcatgctggctgcc
gagaaggccggggtgaccccggaagccttcatcgccaacgtccaggccagccacgagcgc
gatttcgcggcgttcggcgtgaccttcgaccactacgattcgaccaattcgccggtcaat
cgcgagctcaccgaagccttctacgccaagctggaggccgccggccatatcagccggcgc
tcggtggcgcagttctacgatacggccaagggcatgttcctgccggaccgctacatcaag
ggcatctgccccaactgcggcagccccgaccagtacggcgacaactgcgaagtgtgcggc
gccacctatgcgccgaccgagctgaaggaaccgaagtcggtgatttcaggcgccaccccg
gaactgcgcgattcggagcatttcttcttcgaagtgggccatttcgacggatttttgcgc
gagtggcttgccggcgatgtggcgcttcccggggtcaaggccaagctcaaggaatggctg
gatgccgagggcggcctgcgcgcctgggacatctcgcgcgatgcgccgtatttcggcttc
cagattcccggccagccgggcaagtatttctacgtgtggctggatgcgccgatcgggtac
ctgtgcagcttcaagacgctgtgcgcgcagatgggcgaaaatttcgaagcgcatcttgtc
gccggcacccagaccgagctgcatcacttcatcggcaaggacatcgtgaatttccacggc
ctgttctggccggccgtgctgcacggcaccggccaccgcgcgccgacccgcctgcacgtc
aacggctacctcaccgtggacggggccaagatgtccaagtcgcgcggcaccttcgtgatg
gcgcggaccttcctggatgtcggcctggaaccggaagcgctgcgttactacttcgcggcc
aagtcctccggcggcgtggacgacctggacctcaacctgggcgatttcatcgcacgcgtg
aatgcggacctggtcggcaagttcgtcaacctggccagccgttgcgccggcttcatcggc
aagcgcttcgatggcaaactggccgacgccctacccgatgccgcccagtacgaccgcttc
gtcgccgccctggcaccgatccgcgaggcctacgaacgcaacgatgccgccagcgcgatc
cgccagaccatggcgctggccgacgaggccaataaatacatcgacgacaccaagccgtgg
gtgatcgccaagcaggatggcgccgatgcgcagctgcagtcggtctgcacgcagggcctg
aacctgttccgcatcctggtggccgcgctcaagccgatcctgccgcgcacctgcgccgaa
gccgaagccttcctgtcggcgccgatgaccagttgggaagacgtgatcggcccgctgacg
gcgcacacgatccagccctataccgccctgtttacccgtatcgaccccaaactgatcgac
gccatgaccgacgcttccaaggacaccctcgccgcacctgcaacaccggctaccgcctcc
aagcctgcaccggccaaggcggacgcaaagcccgctgcagcggcgaatccccaatccccc
atcgccactcccggcttcatcggcatggacgatttcgccaagctcgacctgcgcatcggc
aaggtgctggcgtgcgaattcgtggaaggctcggacaagttgctgcgcttcgaactggac
gccggcgaactgggcacgcggcagatcttctccggcattcgcgccagctatcgcgaaccg
gaaacgctggtcggccgcagcgtggtgttcattgccaacctggccccgcgcaagatgcgc
tttggcatcagcgaaggcatgatcttgtcggctggcttcgacggcggcgccctggcgctg
ctggacgccgacagcggcgcacagccgggcatgccggtcaggtga

DBGET integrated database retrieval system