KEGG   Xanthomonas citri pv. citri MN12: J164_03317Help
Entry
J164_03317        CDS       T03735                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific, Pseudomonas-type
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
xcm  Xanthomonas citri pv. citri MN12
Pathway
xcm00562  Inositol phosphate metabolism
xcm00564  Glycerophospholipid metabolism
xcm00565  Ether lipid metabolism
xcm01100  Metabolic pathways
xcm01110  Biosynthesis of secondary metabolites
xcm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:xcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    J164_03317
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    J164_03317
   00565 Ether lipid metabolism
    J164_03317
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    J164_03317
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:xcm02042]
    J164_03317
Enzymes [BR:xcm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     J164_03317
Bacterial toxins [BR:xcm02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   J164_03317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756
Motif
Other DBs
NCBI-ProteinID: AJY96581
Position
3688708..3690561
Genome map
AA seq 617 aa AA seqDB search
MADAVCAGYGSAIRLHARARPPHSWVDAQRAWDHGRLGHWAAAKHNHALGYYRRADIPFQ
YALADAFTICDAYHAAIQTGTNSNRVFLWTGGNDPQARAGGPVIGNSHDNFAELGGFAEP
YHWGTYVQALQHAGVSWQIYQDMADNFTDNPLAGFAAFRQAYSAAPGHDPQLRARGVSTR
GLALLREDVLGGRLPAVSYIIADAAGSEHPDPSSPAQGAAYTARVLDALTADPAVWSRTA
LLVMFDENDGFFDHMPPPAPPSPDARATGGFAGASTVATDDDYHRHPAPGEQKVDLPELR
GRPYGLGPRVPMYVVSPWSRGGWVDSQVYDHTSVLRLLERRFGVPAPEITPWRRAVCGDL
TNAFDFRQTDARPFAAALPDVGATAARAAALREHALPPLPATLQPPEQPFGVRRSRGLPY
RPSVELTYLPERGEVNLRMANAGAAAVLHVYDRFDLAAIPRRYTVGNDATVDGTWTTYDG
RYDLWLPGPNGFHRHYRGDVGAPLLVAEIARDPNDCTCMLLSLRHGGSTAVQLELQPGAY
AAAQPRERLRLAPGITEQRRWKAAATGGWYDLWVHHDGAAQRLAGRIETGADSVSDPAMG
GPARLQQELPILIGALD
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacgccgtttgcgctggatacggcagcgcaattcggcttcatgcgcgtgcaagg
ccgccgcatagttgggtggatgcgcaacgcgcctgggatcacggccggctcggccactgg
gccgccgccaagcacaaccatgcgctgggctattaccggcgcgcggatatcccgttccag
tacgcgctcgccgacgccttcaccatctgcgatgcgtaccacgccgcgatccagaccggc
accaattccaatcgcgtgttcctgtggaccggcggcaacgatccgcaggcgcgcgcaggc
ggcccggtgatcggcaattcgcacgacaactttgcggaactgggcggttttgccgagccg
tatcactggggcacctacgtccaagcgctgcagcacgccggtgtgtcctggcagatctat
caggacatggcagacaacttcaccgacaacccattggccggctttgcggcatttcgacag
gcgtacagcgccgcgcccggacatgatccgcaacttcgcgcgcgtggcgtgagcacgcgc
ggtcttgcgctgctgcgcgaggacgtgctgggcgggcgcctgcctgcggtgagctacatc
attgccgatgcggccggcagcgagcatccggatccgtccagccccgcccagggcgcggcc
tacaccgcacgcgtgctggatgcgctcacagccgatccggcggtgtggagtcgcaccgcc
ttgctggtgatgttcgacgagaacgacggcttcttcgaccatatgcccccgcccgcaccg
ccgtcgccggatgcacgcgcaactggcggatttgccggcgcatcgacggttgccaccgac
gacgactatcaccgccacccggccccgggcgaacagaaagtggatcttcccgaactgcgc
gggcggccctatgggcttggcccgcgcgtgccgatgtatgtggtctcgccatggagccgc
ggcggctgggtggattcgcaggtgtacgaccacacctcggtactgcgtctgctcgaacgc
cgcttcggcgtgcctgcgccggagatcacgccctggcggcgtgcagtgtgcggcgacttg
accaacgccttcgatttccgccagaccgatgcgcgccccttcgccgcggcgctgcccgat
gtcggcgcaaccgcagcgcgcgcagcagccttgcgcgagcatgcactgccgccgttgccg
gccacgttgcagccgcccgagcaaccgttcggcgtgcgccgctcgcgcgggctgccgtat
cgtcccagcgtggagctgacctacctgcccgagcgcggcgaagtgaacctccgcatggcc
aacgcgggcgcagcggcggtgctgcatgtctacgaccgcttcgatctggccgcaattccg
cgccgctatacggtgggaaatgacgccaccgtggacggcacgtggaccacctacgacggc
cgctacgatctgtggctgcccggtcccaacggcttccatcgtcactatcggggcgatgtg
ggtgcaccgctgctggtggccgagatcgcgcgggatccgaacgattgcacctgcatgctg
ctatcgctacgtcacggcggcagcactgccgtgcagcttgagctgcagccaggtgcatat
gcagccgcacagccgcgcgagcgcctgcgccttgcacccggcatcaccgagcagcggcgc
tggaaggcggcagcaaccggcggctggtacgacctatgggtgcaccacgacggcgcggcc
cagcgtctggccgggcgcatcgaaaccggcgcagacagcgtcagcgacccggccatgggt
gggccggcgcgattgcagcaagagttgcctatcttgataggcgcactcgattaa

DBGET integrated database retrieval system