KEGG   Xanthomonas citri pv. citri MN12: J164_04471Help
Entry
J164_04471        CDS       T03735                                 

Definition
(GenBank) DNA helicase/exodeoxyribonuclease V, beta subunit
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
xcm  Xanthomonas citri pv. citri MN12
Pathway
xcm03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:xcm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    J164_04471
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xcm03400]
    J164_04471
Enzymes [BR:xcm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     J164_04471
DNA repair and recombination proteins [BR:xcm03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     J164_04471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_30 AAA_11
Motif
Other DBs
NCBI-ProteinID: AJY97715
Position
complement(5075443..5079174)
Genome map
AA seq 1243 aa AA seqDB search
MSISPVTDPYLQLPLHGVRLIEASAGTGKTFTLATLFTRLVVERGLRIGQILAVTFTEAA
TQELRRRIRERLVLAASLVPDAPPPFVGAALAAGDLADDPSRPGPLLHATPDVLLTGAIL
ATHLAGASETPAALRRRLQQAVEEIDLAAVFTIHGFCARVLREHALESGQAFAAPELLAN
DRELLGEVAADLWRQRAADAVMAEDLIALWSGGPEALASDLRALVRHPQLLPRPSTPAPD
PTPIRQAAAQALVATLRAHGDTAYDAIASAFDNKVFDGRRARRASFDKAFEELWNGTADA
HWILDEKAHLDKLLPARMREFCRDGAHDRVPCSPLFDALQVWRQADIQVQQWQQNRRIAL
LHALRDDAIARLALLKRQRRVQTYDDLVDGVAHALQGAQADALLKRLRTQYAIALVDEFQ
DTDDRQWSIFSNVFGEGPLAQAAGLEPALFLIGDPKQAIYGFRGGDVRTYLAAAVTAERA
PPLSHNFRSRPGVLAAIDALYAQAGYADAFLTDGIAFHPVRAGTKRVDEDLQRDGVTAPA
LTLWRAPEPPPPAKGKPKPWSAGRARELATAACVAAIRGWLAGGRDGTATVCGRPVQAGD
IAVLVRSHGEATRIQQALGAVGIPAVAAGKQSLFATEEALELLALLQALLDPGDDSRLRA
ALATVLIGEDAIAIAALERDGERHRRWQQQALDWRERWQRGGPLALIGDLGATHGQRLLA
LVDGERRLTNYLQLAELLQEADARALGPHGLVDWLSRRIANADDNDDAQQLRLESDARRV
QIVTLHKSKGLEYPLVFLPYVGIGRKPPDQKPGKRVIVYRDGKRCLHWPDDVDSMEWKAI
KEEWKKEQDAEDARLLYVGLTRAEHALWIASGPFHQHERTALSAMLRALDALQGTAGEGG
VVVDTTTPPAHLPRLPAPSEAQVPLARNPQRHIAPEWWVYSFTQLANADAGAATDPMASA
TVVGSGGSDEPSGSEAVAVAVATDAEPFDPRFAGNRFGVVMHDVFERCDFAAWQAWRPGQ
TAPDGQAAPILEALQRGGYAQDDLDDGLRMLTALIGHTLTVALPEGTRLADVPEPQRRNE
MEFHFAMRPTRVDALLALLHRFGVVGDRQAFGARQRLEGLMTGLIDLTYSVDGRWYVLDY
KSNRLPSYDADALARAMAHSEYELQALIYTVALHRWLRFRLGDAYDYARDFGGVRYLFCR
GLDAARPAVEGMPAPGIHAWRFAPALVQSLDALFAGAPPEALA
NT seq 3732 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcagccccgtcaccgacccgtatctgcagttgccgctgcacggcgtgcgcctg
atcgaggccagcgccggcaccggcaagacctttacgctagcgacgctgttcacgcggctg
gtggtcgagcgcggcttgcgcatcggccagatcctggcggtgaccttcaccgaagccgcc
acgcaggagctgcgccgccgcatccgcgaacgcctggtgctggccgcaagcctggtcccc
gatgcgccaccgcctttcgtaggagcggccctggccgcgggcgaccttgccgacgacccg
tcgcggccaggtccgctcctacacgcaacacccgacgtgctgctcaccggcgccatcctc
gccacgcatctggccggcgccagcgaaacgcccgccgccttgcgtcgccgcctgcagcag
gcggtggaagaaatcgatctggctgcggtgttcaccatccacggtttttgcgcgcgcgtg
ctgcgcgaacacgcgctggaaagcggccaggcgttcgctgcgccggaattgctcgccaac
gatcgcgaattgctcggcgaagtcgcggccgatctgtggcggcagcgcgccgccgatgcg
gtgatggccgaagatctcatcgccctgtggtcgggcggccccgaggccttggccagcgat
ctgcgcgcgctggtgcggcacccgcagttgctaccaaggccttcaacgccagcacctgat
ccaacaccaatccgccaagctgccgcgcaagccttggtcgctaccctgcgcgcgcacggc
gacacggcttacgacgccatcgcctccgcattcgacaacaaggtcttcgatggtcgccgt
gcgcgccgtgcaagttttgacaaggcttttgaagagttgtggaacggtactgccgatgct
cactggatactggacgagaaggcacatctagacaaattgctgcctgcacgcatgcgcgaa
ttttgcagggatggggcgcacgatcgcgtaccgtgctcacccttgttcgatgcgttacaa
gtgtggcgacaagctgacatacaggtacaacaatggcagcaaaaccgccgtatcgcgttg
ctgcatgcgctacgcgacgatgccatcgcacggctggcgctgctcaagcggcaacgccgc
gtgcagacctacgacgacctcgtcgatggtgtcgcgcacgcattgcagggcgcacaggcc
gacgccctgctcaaacgcctgcgcacgcaatacgccatcgcgctggtggacgaattccag
gacaccgacgaccgccagtggtcgatcttttccaacgtgttcggcgaaggcccgctcgca
caagccgccggactggaaccggcgctgtttctgatcggcgaccccaagcaggccatctac
ggcttccgtggcggcgatgtgcgcacctatctggccgcggcagtcaccgccgaacgggcg
ccgccgctgagccacaacttccgctcgcgccccggcgtgctggcggccatcgacgcgctg
tacgcgcaggccggctacgccgatgccttcctcaccgacggcatcgccttccacccggtg
cgggctgggaccaagcgcgtcgatgaagacctgcaacgcgatggcgtcactgcgccggca
ctgacgctgtggcgggcgccggaaccgccgccgcctgcgaaaggcaagcccaagccctgg
agcgccggccgcgcgcgcgagctggcgaccgccgcgtgcgttgcagcgatccgcggctgg
ttggccggtggccgcgacggcacggccacggtgtgcggtcgcccggtgcaggccggcgat
atcgccgtgctggtgcgcagccacggcgaggccacgcgcatccagcaggcgctcggcgcg
gtgggcatcccggcggtggccgccggcaagcaaagcctgttcgccacggaagaggcgctg
gaattgcttgccttgctgcaggccttgctcgacccgggcgacgacagccgcctgcgcgcc
gccttggccacggtcttgatcggcgaagacgccatcgccatcgccgcacttgaacgcgac
ggcgagcgtcaccgccgctggcagcaacaggcgctggactggcgcgaacgctggcagcgc
ggcggcccgctcgccctgatcggcgacctcggcgccacccacgggcaacgcctgctcgca
ttggtcgatggcgaacgccgcctcaccaactatctgcaactggccgaactgctgcaggaa
gccgatgcgcgcgcactcggcccgcatggcctggtcgactggctgtcgcggcgcatcgcc
aatgccgacgacaacgacgacgcccagcagctgcggctggaatcggatgcgcgccgcgtg
cagatcgtcaccctgcacaagagcaagggcctggaatatccgctggtgttcctgccgtat
gtcggcatcggccgcaagccaccggaccagaagcctggcaagcgtgtgattgtttatcgg
gatggcaaacgctgtttgcattggcctgatgacgttgactccatggaatggaaagcgatc
aaagaggaatggaagaaggagcaggatgccgaagacgcgcgcctgctctatgtcggcctc
acccgcgccgagcacgcgttgtggatcgccagcggcccgttccaccagcacgaacgcacc
gcattgtcggccatgctgcgtgcgctcgatgcgctgcagggcacggcgggcgagggcggc
gtggtggtggacaccaccacgccgccggcccacctgccgcggctgccggctccgagcgag
gcgcaggtgccgctcgcgcgtaatccgcagcgtcacatcgcacccgagtggtgggtgtat
agctttacccaactggccaacgccgatgccggcgcggccaccgacccgatggccagcgcc
accgtcgtcggcagcggcggcagcgatgaaccgtccggcagcgaggcggttgccgtggcc
gttgccaccgacgccgagccgttcgatccgcgctttgccggcaaccgcttcggcgtggtg
atgcacgacgtgttcgaacgttgcgacttcgccgcctggcaggcctggcggccgggccaa
accgcgcccgacggccaggccgcacccatcctggaggccctgcaacgcggcggttacgcc
caggacgacctcgacgacggcctgcgcatgctcaccgcgctgatcggccacacgctcacc
gtcgcattgcccgaaggcacccgcctggccgacgtgcccgaaccgcagcgccgcaacgag
atggaattccatttcgccatgcggcccacccgcgtcgatgcgttgctcgccttgctgcat
cggtttggcgtggtcggcgaccgccaggccttcggcgcgcgccagcgcctggaaggcctg
atgaccggcctgatcgacctcacctacagcgtggacgggcgctggtatgtgctggactac
aaatccaaccgcctgcccagctacgacgccgacgccctggcgcgggccatggcgcacagc
gagtacgaactgcaggcgctgatctacaccgtggccctgcaccgctggctgcgcttccgc
ctgggcgacgcctacgactacgcccgtgacttcggcggcgtgcgctatctgttctgtcgc
ggcctggatgcggcacgccccgcggtcgagggcatgccggcgcccggcatccacgcctgg
cgcttcgcaccggcgctggtgcagtcactggatgcgctcttcgccggcgcgccgcccgag
gcactcgcatga

DBGET integrated database retrieval system