KEGG   Xanthomonas citri pv. citri MN12: J164_04481Help
Entry
J164_04481        CDS       T03735                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
xcm  Xanthomonas citri pv. citri MN12
Pathway
xcm00480  Glutathione metabolism
xcm00590  Arachidonic acid metabolism
xcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    J164_04481
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    J164_04481
Enzymes [BR:xcm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     J164_04481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AJY97725
UniProt: A0A0U5FDX4
Position
complement(5088526..5089077)
Genome map
AA seq 183 aa AA seqDB search
MSQTLYDIPVTRIDGQPTTLADYRGKVLLVVNVASKCGLTPQYEGLEALYRDKRAQGLEV
LAFPANDFNGQEPGSEAEIAQFCQLTYDVTFPMFAKIAVAGDQAHPLYGALTSTHPHTTG
EGPMREKLAGYGIAPNPAPGVVWNFEKFLIGRDGKIIDRFAPDIPADDARLRAAIDAALA
TRS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagccagacgctatacgacattcccgtgacccgcatcgatggccagcccaccaccttg
gcggactatcgcggcaaggtgctgctggtggtcaacgtcgcctccaagtgcggcctgacc
ccgcagtacgaagggctggaagcgctgtatcgcgacaagcgcgcacagggcctggaagtg
ctggcgtttccggccaacgacttcaacggccaggagccgggcagcgaagcggagatcgcg
cagttctgccagctcacctacgacgtcaccttcccgatgtttgccaagatcgccgtcgct
ggcgaccaggcgcacccgctgtatggggcactgaccagcacccatccgcacaccaccggc
gagggcccgatgcgcgagaaacttgccggttacggcatcgcccccaaccccgcgccgggc
gtggtgtggaacttcgaaaaattcctgatcggtcgcgacggcaagatcatcgaccgcttc
gccccggacattcctgccgacgatgcgcgcttgcgtgccgcgattgatgcggcgctggcc
acacgctcatag

DBGET integrated database retrieval system