KEGG   Xanthomonas citri pv. citri NT17: J169_00326Help
Entry
J169_00326        CDS       T03734                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xcn  Xanthomonas citri pv. citri NT17
Pathway
xcn00071  Fatty acid degradation
xcn00072  Synthesis and degradation of ketone bodies
xcn00280  Valine, leucine and isoleucine degradation
xcn00310  Lysine degradation
xcn00362  Benzoate degradation
xcn00380  Tryptophan metabolism
xcn00640  Propanoate metabolism
xcn00650  Butanoate metabolism
xcn00900  Terpenoid backbone biosynthesis
xcn01100  Metabolic pathways
xcn01110  Biosynthesis of secondary metabolites
xcn01120  Microbial metabolism in diverse environments
xcn01130  Biosynthesis of antibiotics
xcn01200  Carbon metabolism
xcn01212  Fatty acid metabolism
xcn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    J169_00326
   00630 Glyoxylate and dicarboxylate metabolism
    J169_00326
   00640 Propanoate metabolism
    J169_00326
   00650 Butanoate metabolism
    J169_00326
  09103 Lipid metabolism
   00071 Fatty acid degradation
    J169_00326
   00072 Synthesis and degradation of ketone bodies
    J169_00326
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    J169_00326
   00310 Lysine degradation
    J169_00326
   00380 Tryptophan metabolism
    J169_00326
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    J169_00326
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    J169_00326
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    J169_00326
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcn04147]
    J169_00326
Enzymes [BR:xcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     J169_00326
Exosome [BR:xcn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   J169_00326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJY89181
Position
260733..262013
Genome map
AA seq 426 aa AA seqDB search
MPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVAMGAVI
KHSADWNLAREAALSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIGGGSDT
TSEVPIVYGKKLRARLLAANRAKATGDKLRALLRGFKLAELKPEFPGVAEPRTGKSMGDH
CEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDALIAPFRGVSRDNILRADTSLEKL
ATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSSEAWALAHGHTPMAYLRDAQVAAVDF
VHGEGLLMAPTIAVPQMLARQGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCRNRLGL
DAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTAGGMGV
VAIVER
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcagcccgtcccgtcgccattctgggcggcgttcgtatcccgttctgtcgtcag
aacaccgcctacgcggacgtgggcaacctgggcatgtcggtgcgcacgctgggcgcgttg
gtcgagcgcttcgggttgcatgggcagcaattgggcgaagtggcgatgggcgcggtgatc
aagcactccgcggactggaacctggcgcgcgaggcggcgctgtcgtcgggtctgtcgccg
ctgacgccgggcatcaccctgcagcgcgcctgcggcaccagcctggattcggtcatcacc
atcgccaacaagatcgcgctggggcagatcgactcgggcatcggcggcggctccgacacc
acctccgaagtgccgatcgtgtacggcaagaagttgcgcgcacggctgctggccgccaac
cgcgccaaggccaccggcgacaagctcagggcgctgctgcgcggcttcaagctggccgag
ctcaagcccgaattccccggcgtggccgagccgcgcaccggcaagagcatgggcgaccat
tgcgaggacatggccaaggaatggaacatctcgcgcgattcgcaggacgaatgggcggtg
gcctcgcaccacaagctggccgctgcctatgagcgcggtttcttcgacgcgctgatcgcg
ccgttccgcggcgtctcgcgcgacaacatcctgcgcgccgacacctcgctggaaaaactc
gcgaccttgcgaccggccttcgacaagacctccggccgtggcacgttgaccgctgccaat
tccaccccgctcaccgatggcgccgccgcggtgctgctctccagcgaagcctgggcgttg
gcgcatggccacacgccgatggcctacctgcgcgatgcacaggtggcggcagtcgacttc
gtgcatggcgaaggcctgctgatggcgcccaccattgcggtgccgcagatgctggcgcgc
cagggcctgaccctgcaggacttcgatatctacgaaatccacgaggccttcgccgcgcag
gtgctgtgcacgctgcgcgcgtgggagagcgaggactactgccgcaaccggctgggcctg
gacgcgccgctgggccgcatcgacccggacaagatcaatccgctgggctcgtcgctggcc
accggccatccattcgccgccactggcgcacgcgtggtggccaccgctgccaagcagttg
gaagagcgcggcggcggccgcgcgttgatttcgatctgcaccgccggcggcatgggcgtg
gtggccatcgtcgagcgctga

DBGET integrated database retrieval system