KEGG   Xiphophorus couchianus (Monterrey platyfish): 114133278
Entry
114133278         CDS       T05908                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114133278 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xco03000]
    114133278 (mecom)
Transcription factors [BR:xco03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    114133278 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED PyrI_C
Other DBs
NCBI-GeneID: 114133278
NCBI-ProteinID: XP_027854840
Position
18
AA seq 1266 aa
MRSKGRARKLATSDGNDDFGFFPSNMLDNACGSDGDPTPSSALTDDPLSDDEFSPQSLQQ
ASIFFPQGNLTIPLDFELRESSVPGATLGIWSRRKVNIGERFGPYEGEHAPCLQDPTQGW
EILDGSGHVKFCLDASKPDAGSWLKHIQFAPAATQHNLRACQTDEQIFYKVTREIFPGEE
LLLFMKAEEYFCDTMAPDIHEERQYRCEDCNQHFESRNELLDHQKEPCGMPPSAFLNPGG
DADLTAQEPQDLRPLHMSHGLHECKECDQVFPDVQSLENHSQSHSEEREYKCDQCPKAFN
WKSNLIRHQMSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATS
SGLKQHKHIHSSVKPFMCKSLRPYLCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQ
MFSTTSSLNKHRRFCEGKNHFTAGGLFAQGLPLPGTPGLDKSALTLGHSSAGLADYFGAS
RHHSGLTFPAAPAFPFSFPGLFPSGLYHRPQLIPATSAPIRQTAHAPVTGPGVELRKSPL
LPPSPGALESQELLKALCKNGSSPGNDIHDSELPNQGSSVSTKQQNKQSDQSESSDVDDV
STPSGSDLESTTGSELESDMDSERERGVARENGKGPRRKATERDPQSPSLIGSSTAKGFP
GQSLMQSSLDEHTAVTGAVNDSIKAIASIAEKYFGSAGLAGLQDKKVGSLPYPSMFPLPF
FPTFSPPVYPLPDRDLRPTGVKGEPQSPGDDCKKAQSKSSESPFDLTTKRKEGKLSQFVP
TKTDVANVTGQDQPLDLSLGSRGRGQIPCQEETRKNKSFEEAKRAVDVPKADTSLQHARP
TPFFMDPIYSRVEKRRMSDPFETLKDKYMRPTPGFLFHPQFRLPDQRTWMTAIESMAEKL
ETFGSLKPESGELLRSVPSMFDFRAPPSTLPETLLRKGKERYTCRYCGKIFPRSANLTRH
LRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKK
HENGHLSGTAMSSPQSELDSSSAILDDKEDSYFNEIRNFISSASQNQTSPDPSEEGLNGG
LLEEGKPLMPSHGSRDLEDEEGEDLDAEEEEAEEPRNSPQKTDVKVHPSSVGDDEMDFIE
PNDLNLSCKTSPRRYSHEEEQSSFSALDHIHRFSDLRKMEESELSDGDGDGDGDGDEDDG
SFASPSLAKAVKQPLFRKSKSQAYAMMLSLAEKDSLHSTPHTPATMWHSLARVAAESSAI
QSLSHV
NT seq 3801 nt   +upstreamnt  +downstreamnt
atgaggtccaaaggcagggcgcggaaactggccacgagcgatggcaacgatgactttggc
ttctttccaagcaacatgttggacaacgcatgtggctccgacggcgatcctacaccttct
tcagccctgacagatgatccgctctctgacgatgagttttcacctcagtcacttcaacaa
gcaagcatcttttttcctcaaggcaatttaaccattcctctggactttgaactgagagag
tcatcagttccaggtgcaactctgggtatctggagccgcaggaaggtgaatataggagaa
cgctttggaccatatgagggggagcacgccccatgtctccaagaccctacgcaaggctgg
gagatcttggatgggtcaggccatgtaaagttctgcctggatgccagcaaaccagatgca
gggagctggctgaagcacatccagtttgcccctgcggccacgcagcataacctcagagcg
tgccagacagatgagcagatattctacaaagtcactagagagatttttcctggcgaggaa
ctattacttttcatgaaggctgaagagtatttctgcgacacaatggctcctgatattcat
gaggagaggcagtaccgctgtgaggactgcaaccagcactttgagtcccgcaacgagttg
ctggatcatcaaaaggagccgtgtgggatgcctccctctgctttcctcaacccaggaggg
gacgctgacctgacagctcaagaacctcaagatttgcggccccttcatatgtctcatggc
ctacatgagtgtaaggagtgtgaccaggtcttccctgatgtccagagtttggagaaccac
agtcagtcgcactctgaggagagggaatacaagtgtgatcagtgccccaaggctttcaac
tggaaatcaaacttgatccgacatcagatgtcgcatgacagtggcaagcactatgaatgt
gaaaactgctcaaagcaggtgttcacagaccccagtaacctgcagaggcacattcgctct
cagcacgtcggggctcgggcccatgcctgctccgactgcggaaagacgtttgcaacgtct
tcgggcctcaagcagcataagcacattcacagcagtgtcaagcccttcatgtgtaagtca
ctaagaccctacctatgtgaggtatgccacaagtcctatacccagttctctaacctttgc
cggcacaaacgcatgcatgctgactgtcgcacacagataaaatgcaaggactgtgggcaa
atgttcagcaccacctcgtccctcaacaaacaccggcggttctgtgaaggaaagaatcat
ttcacagcaggggggttgtttgctcagggtttaccactccctggtacccctggcttagac
aaatcagctctcacgctcggtcacagcagcgctggacttgctgattacttcggcgcaagc
cgccaccatagtgggcttactttccctgcagccccagcatttcctttcagcttccccggc
ctgtttccttctggactatatcaccggccacagctcattcctgccacctccgctcctatt
agacagacagctcatgcacctgttacagggcctggtgtagaactaaggaaaagtcctttg
cttcctccgagccctggtgctctggagtctcaagaactgttaaaagctctgtgcaaaaat
ggcagttcacctggaaacgacatacatgactcagaacttcccaatcagggctcttcggtg
tccacaaaacagcagaacaagcaaagtgaccaatctgaaagcagcgatgtggacgacgtc
agcacaccaagtgggagtgatcttgagagcacaacgggctctgaactcgaaagcgacatg
gacagtgaaagggagaggggagttgctcgagaaaatggcaaaggtcccaggagaaaggcc
actgagagagaccctcaaagtcccagcttgatagggagcagtactgctaaaggctttcca
ggccaatcccttatgcagtcgtcactagacgagcacacggctgtaacaggggctgtaaat
gactctattaaggccattgcctctattgcagagaaatattttggctcagctggactggct
ggcttgcaggacaagaaggttgggtctctgccctacccctctatgtttccactgcctttc
ttcccaactttctctccaccagtttaccccttgccagacagggacctcagaccaacaggc
gtgaagggtgagccacagtcgccaggagatgactgcaagaaggctcaaagcaagtcatct
gagtcaccatttgacctcactaccaagcgaaaggagggcaaattgtcccagtttgttccc
accaaaaccgatgttgcaaatgttactggtcaggaccagccactcgatctaagcctgggt
tcccggggccgtggacagattccatgtcaggaggagaccaggaagaacaaaagctttgaa
gaggcgaagagagcagtggatgttcctaaagcagacacctccttacagcatgccaggccc
acaccttttttcatggaccctatctacagcagggttgagaagaggagaatgagcgatccg
tttgagactctgaaagacaagtacatgcggccaactccaggcttccttttccatccacaa
tttcgtttgccagatcagagaacttggatgacggccattgagagcatggcggagaagctg
gagacatttggctccttgaagccagagtcgggagaactgctgcgctccgttccgtccatg
ttcgacttcagagctccaccctccactcttccagagacactgttgcgcaagggcaaggag
cgctacacatgcagatactgtggaaaaatattccctcgttctgccaacctgactcgccat
ctcaggactcatactggagagcagccatacaggtgtaaatactgcgaccgctccttcagc
atctcctctaacctgcagcggcacattcgcaacattcacaacaaggagaaacccttcaag
tgccacctgtgcgaccgctgctttggccagcagaccaaccttgaccgccacctcaaaaag
catgaaaacggccacctgtcaggaactgcaatgtcatccccgcagtcggagttggacagc
agcagtgccatattggacgataaagaagactcctattttaatgaaataagaaattttatt
agcagcgcaagtcagaaccagacatcaccggacccctctgaagaagggctaaacggaggc
ctgttggaggaggggaaacccctgatgcccagccacggctcacgtgacctggaagatgag
gaaggcgaagacctggatgcagaggaggaagaagcagaggagccgagaaacagtcctcag
aagacagacgtcaaggtgcatcccagcagcgtcggcgacgatgaaatggacttcattgag
cccaacgatttaaacctcagctgcaaaacctctcctaggaggtattcacatgaagaggaa
cagagcagcttctcagctttggatcacatccatcgtttctcggatctgcgcaaaatggag
gagagcgagctgagtgacggagatggagatggagatggagatggagatgaggacgatgga
tccttcgcctccccatcactcgccaaggcagtcaaacagccactctttaggaaatccaag
tctcaggcgtatgccatgatgttgtctctggctgaaaaggactctctccactccaccccc
cacaccccggccaccatgtggcacagtctggcacgggttgcggctgaatccagtgccatt
cagtcccttagccacgtatga

DBGET integrated database retrieval system