KEGG   Xiphophorus couchianus (Monterrey platyfish): 114135012
Entry
114135012         CDS       T05908                                 

Definition
(RefSeq) retinol dehydrogenase 7-like isoform X1
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    114135012
Enzymes [BR:xco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     114135012
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 Phage_rep_O
Other DBs
NCBI-GeneID: 114135012
NCBI-ProteinID: XP_027857717
Position
20
AA seq 365 aa
MINIVFMLYLLFKHFCRMFFEQFRGQKQTPEGNMNTQYIYELLGENASYYIAASFALLWI
LVWLYRDSLEIENLSDKYVFVTGCDTGFGNLLCKKLDRRGFRVLAGCLTEKGADNLRRVT
GPHLKTVLLDVTSQSSIQAAMEWAKKEVGNRGLWGIVNNAGRSLPMGPSEWMRVEDFQST
LKVNINGVIAMTMTFLPLIKKARGRIVNVASVLGRVAANGGGYCISKFAVESFSDCLRRD
ISYFGIKVCIIEPGFFKTEVTNLDPIERELHRLWNQLSPEVKASYGEKYLDNYIKIQRLI
MNAVCDSDLTKVTSCMEHALTAAHPRTRYSAGWDAKLLWIPLSYMPSFVVDIGLKLVLPR
PTKSV
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgattaacattgtatttatgctttatttactttttaaacatttttgcagaatgtttttt
gagcagtttcgaggccaaaaacaaactcctgaaggcaacatgaatacacagtatatatac
gaacttttaggagaaaatgcttcgtactacattgcagcttcctttgctttgttgtggatt
ctggtgtggctgtacagagacagcctggagatagagaacctttctgacaagtatgtcttc
gtgactggctgtgacacagggtttggcaaccttctgtgcaagaagctcgaccgtagaggt
tttcgagttctggctggctgtctcacagagaagggagctgataatttgagaagagtgaca
gggcctcaccttaagacggtcctgctggatgtgaccagtcagagcagcatccaggcagct
atggagtgggccaagaaggaggttggaaatagaggactttggggcattgtgaacaatgct
ggacgttccttacccatgggtccttcagagtggatgcgagtggaagatttccaaagcaca
ctgaaagtgaacattaatggcgtcattgccatgactatgaccttcctgcccctcattaaa
aaggcccgtggacgtattgtaaatgtggcatctgtcctcggcagggtggctgcaaatggt
ggcggatactgcatctccaagtttgcagtggagagtttctctgactgcctgaggagagat
ataagttactttggaatcaaagtgtgcatcattgagccagggtttttcaagacagaagtt
accaaccttgatcccattgagagggagctgcaccgtctctggaatcagctcagccccgaa
gtaaaagcaagctatggagagaagtacctggataactacatcaagatccagcgtttgatc
atgaatgctgtatgtgactcagacctcaccaaggtgactagctgcatggagcacgctctg
actgcggctcacccacgcactcggtacagcgccggctgggatgctaagcttctctggatc
cctctctcttacatgccttcctttgtggttgatattggactaaagctggtgctacctcgt
cctaccaagagtgtgtaa

DBGET integrated database retrieval system