KEGG   Xiphophorus couchianus (Monterrey platyfish): 114135726Help
Entry
114135726         CDS       T05908                                 

Gene name
mapkapk2
Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04218  Cellular senescence
xco04370  VEGF signaling pathway
xco04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114135726 (mapkapk2)
   04370 VEGF signaling pathway
    114135726 (mapkapk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    114135726 (mapkapk2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    114135726 (mapkapk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114135726 (mapkapk2)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114135726 (mapkapk2)
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   114135726 (mapkapk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Choline_kinase
Motif
Other DBs
NCBI-GeneID: 114135726
NCBI-ProteinID: XP_027859065
Position
20
AA seq 376 aa AA seqDB search
MLPNAQNQPLFPNPAGQQNPAGHFHARPHLQIKKNAITDEYKITGQVLGLGINGKVVEIF
QRKTGDKYALKMLQDCPKARREVELHWRASPCANIVRIIDVYENLYQSKKCLLIVMECMD
GGELFSRIQDRGDQAFTEKEASDIMKSIGEAIQFLHAINIAHRDVKPENLLYSSKRPRAL
LKLTDFGFAKETTSHNSLDTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPP
FYSNHGLAISPGMKKRIRMGQYEFPNPEWSEVSEEAKQLIRTLLKTEPTQRMTITEFMNH
PWINQSMKVPQTPLHTSRVLKEERDAWEEVKEEMTSALATMRVDYEQIKIKTIEDSTNPL
LTKRRKKANNPNSAAH
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctaacgctcagaaccaaccactgtttccgaacccggcgggccagcagaacccc
gcgggccacttccacgccagaccccacctacagatcaagaagaacgccatcacagacgag
tacaagatcaccggccaggtgctggggctggggatcaatggcaaggtggtggaaatcttc
cagaggaaaaccggtgacaaatatgcgttaaagatgctgcaggactgtcccaaggcacgc
agggaagtggagctgcactggagggcgtccccatgcgctaatattgtgcgcatcattgat
gtttatgagaacctctatcagagcaagaagtgtctccttatcgtcatggagtgtatggac
ggcggtgagcttttcagtcgaatccaggacagaggagaccaggccttcacagagaaagag
gcgtctgatatcatgaagagcataggagaggccatacaattcttacatgccatcaatatt
gcgcacagagatgtgaagccagagaacttgctgtattcttcgaagaggcccagggctctc
ctgaaactaacagacttcggttttgccaaggagacaacctcacacaactctttagatact
ccctgctacacaccttactacgttgctccagaggttcttggcccagagaagtatgacaag
tcatgtgacatgtggtctttgggcgtcattatgtatattctgttgtgtggataccctcct
ttttattctaaccatggcttagccatctctcctgggatgaagaagaggataaggatgggc
cagtatgaatttcccaaccctgagtggtcagaggtgtcggaagaagccaaacagctgatc
aggaccctcctaaagactgagccgacccaaaggatgaccatcacagagttcatgaatcat
ccatggatcaatcaatcaatgaaggttccccagaccccacttcacaccagtagggtttta
aaggaggagagggatgcatgggaggaagtcaaggaggaaatgaccagtgccttggcaacg
atgagggtcgactatgagcaaatcaaaatcaagaccattgaagactcaaccaatccactg
ctaacgaaaaggagaaagaaagccaacaacccaaactctgctgcccactga

DBGET integrated database retrieval system