KEGG   Xiphophorus couchianus (Monterrey platyfish): 114135841
Entry
114135841         CDS       T05908                                 

Gene name
asic1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Brite
KEGG Orthology (KO) [BR:xco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xco04040]
    114135841 (asic1)
Ion channels [BR:xco04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   114135841 (asic1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 114135841
NCBI-ProteinID: XP_027859256
Position
20
AA seq 560 aa
MPVRIMCTISFSTDDEPSRGYGKDGFDDYYKRIKQDYSDRGSQDYLDRANEEEDLAEEED
DASDVDDLAAFFGGCSLHGANHIFVEEKKFGIRQGLWAVVFTMALSAFLYQVVDRVVYYR
QYDHITMLDERSAKNMTFPAVTMCNYNFIRKSQMSYSDLIFTSPLLGFEEGMAPGFPLAP
EPDRPLGSRFSLDEFYNRTRHRLDEMLLDCTFRGLECGPENFREIFTRYGKCYTFNSGQD
GRPLLVTMKGGTGNGLELMLDIQQDEYLPVWGETDETSFEAGIKVQIHTQDEPPFIDQLG
FGVAPGFQTFVSCQEQRLTYLPPPWGDCKSTAMDSDFFSSYSITACRIDCETRYLVENCN
CRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNDYCVCETPCNMTRYGKELSFVKIPSK
ASAKYLAKKFNKTEQYIADNILVLDIYFEALNYETIEQKKAYELAGLLGDIGGQMGLFIG
ASILTVLELFDYLYEVIKYKLCRCMKKKHKSRSSNDRGAVLSLDDVKHHAPCDNLRTPST
YPGNMLPHHPGQGNFEDFTC
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgccggtccggatcatgtgcaccatctctttttctacggatgacgagcccagcagagga
tacggtaaagatggttttgacgactactacaagcgcataaagcaggactacagcgacagg
ggctctcaggactacctggacagagccaacgaggaggaggatctggctgaagaagaggat
gatgccagcgacgtcgacgacctggccgctttcttcggtggctgctcgctccacggggcc
aaccacatatttgttgaagaaaagaagtttggcattcgtcagggtttgtgggcagtggtg
ttcaccatggcgctgtctgctttcctataccaggtggttgacagggttgtatactaccgc
caatacgaccacatcaccatgctggatgagaggtcagccaagaatatgaccttccctgct
gtcaccatgtgcaattacaacttcattcggaagtcccagatgagctacagcgacctgata
tttaccagccccttgctgggctttgaggaaggcatggcgccgggatttcctctggctccg
gagccggaccgcccgctcgggtcacgcttcagcctcgatgagttctacaaccgcacccgt
catcggctcgatgagatgctgctagattgcaccttcagggggttagagtgtggcccggag
aacttcagagagatatttacacgctacgggaaatgctacacgtttaattcaggccaagat
ggacgacccctactggtgacgatgaagggcggaacgggcaacggcctggagctgatgttg
gacatccagcaggatgaatacctgcctgtgtggggagagactgatgagacatcatttgaa
gctgggatcaaggttcagatccacacccaggacgagccgccgttcatagaccagctgggc
ttcggagtggctccaggatttcagacctttgtttcctgtcaagaacaacggctgacgtac
ctgcccccaccgtggggtgactgcaagtccacggcgatggactcggacttcttcagcagt
tacagcatcactgcctgcagaattgactgcgagacgcgataccttgtcgagaactgcaat
tgcaggatggttcacatgcccggagatgccccgtactgcaccccggagcagtacaaggag
tgtgcagatcctgccttggatttccttgttgagaaggacaatgattactgtgtgtgtgag
accccatgcaacatgactcgatatggcaaagagctgtcctttgttaagatacccagcaag
gcgtcggccaagtacctcgccaagaaattcaacaagacagaacagtacattgctgataac
attctggttttggatatctactttgaggcgctgaactatgaaaccattgaacaaaagaaa
gcctacgaactggcaggccttctgggcgatatcggaggtcagatgggtctcttcataggc
gccagtatcctcaccgttcttgagctgtttgactacctgtacgaggtgatcaagtacaag
ctgtgcagatgcatgaagaagaaacacaaaagccgcagcagcaatgatcggggagctgtg
ctgagcctggatgatgtgaaacaccatgctccttgtgacaacctgcgtacgccgtctaca
tatcctgggaacatgctacctcaccatccgggccagggcaactttgaagacttcacctgc
tga

DBGET integrated database retrieval system