KEGG   Xiphophorus couchianus (Monterrey platyfish): 114136034Help
Entry
114136034         CDS       T05908                                 

Gene name
oxtr
Definition
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04020  Calcium signaling pathway
xco04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    114136034 (oxtr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114136034 (oxtr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xco04030]
    114136034 (oxtr)
G protein-coupled receptors [BR:xco04030]
 Rhodopsin family
  Peptide
   Oxytocin
    114136034 (oxtr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 114136034
NCBI-ProteinID: XP_027859591
Position
20
AA seq 390 aa AA seqDB search
METISNESDIWQLNESWRNSNLLNGTGGLNQTNPLERNEEVAKVEVTVLALVLFLALAGN
LCVLLAIHTTKHSQSRMYYFMKHLSIADLVVAIFQVLPQLIWDITFRFYGPDILCRLVKY
LQVVGMFASTYMLVLMSVDRCLAICQPLRSLHRRKDRFYVIFSWLLSLLFSTPQIFIFSL
REVGSGVYDCWGDFVKPWGAKAYITWISLTIYIIPVAILSICYGLISFKIWQNFKLKTRR
EQCISLTPKTCKSNTLARVSSVRLISKAKITTVKMTFVIVVAYIVCWTPFFSVQMWSAWD
PAAPREAMPFIISMLLASLNSCCNPWIYMCFAGHLFHDLRQNFLCCSARYLKSSQCHCEH
DFDSSHKSNSSTFAIKSTSSQRSITQTSTT
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatttccaatgaaagtgatatctggcaactgaacgaatcttggaggaactcc
aaccttctgaacgggaccggcgggctgaatcaaacgaaccccctggagaggaatgaggag
gtggcgaaggtggaggtgaccgtgctcgctctggtgctcttcttggcgctcgcagggaac
ctgtgcgtcctgctggccatccacaccaccaaacacagccagtcccgcatgtattacttc
atgaagcacctgagcatcgccgatctggtcgtggctatattccaggtcctccctcaactt
atctgggacatcacatttcggttctacggaccagatattttgtgcaggttggttaaatac
ctgcaggttgtcgggatgtttgcatccacttatatgttagttttgatgtccgtagaccgc
tgtttggccatatgccagcctctccgctctctgcacagaagaaaagatcgtttttatgtg
atattttcttggctcctcagcctgctcttcagcaccccgcagatattcatcttttccctc
agagaggtcggctcaggagtgtacgactgctggggcgacttcgtgaaaccctggggagcg
aaagcttacattacatggatcagcctcactatctacattatccccgtggccatactgagc
atttgctacggtctgatcagctttaagatatggcaaaactttaagctgaaaaccagacgc
gaacagtgcatcagcctgacccccaaaacctgcaaaagcaacacgctggcccgggtgagc
agcgtgaggctcatctccaaggcgaagataaccaccgtgaaaatgacttttgtgattgtg
gtggcgtacatcgtgtgctggactccctttttctcagtccagatgtggtctgcgtgggat
ccagctgcaccccgggaggccatgcccttcatcatctccatgctgcttgcaagcctcaac
agctgctgtaacccctggatctatatgtgcttcgctgggcatctcttccatgacctgagg
cagaactttctgtgttgttccgctcgctaccttaagtcatcccagtgccactgtgagcat
gactttgactccagccacaagagcaactcgtcaacctttgccattaagagcaccagcagt
cagaggagcatcacacagacatccaccacgtaa

DBGET integrated database retrieval system