KEGG   Xiphophorus couchianus (Monterrey platyfish): 114136299Help
Entry
114136299         CDS       T05908                                 

Gene name
fancd2
Definition
(RefSeq) Fanconi anemia group D2 protein
  KO
K10891  fanconi anemia group D2 protein
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    114136299 (fancd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xco03400]
    114136299 (fancd2)
DNA repair and recombination proteins [BR:xco03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     114136299 (fancd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 FANCI_S2 CCDC53 CNOT11
Motif
Other DBs
NCBI-GeneID: 114136299
NCBI-ProteinID: XP_027860014
Position
20
AA seq 1446 aa AA seqDB search
MMRKKRHSSVEKVAGTTAATKAKKSRNSGRQPKDAASEEASETAFVTFVKKAGVGLKHNG
ASHEIAVDQVVFQKRIQQQLQKSPRYPDILKEFITDLEAYIENPDRFRNCLLPCIPQLSE
GDVRSVSSFQESLIRMLLGIEMLQTLIISTLLEKLPEFMFDGTVDGGLNIPRMIINQLKW
LDRVVDTKELAVKLMELVSVAPVEVQRDIITSLPEILEDSQHNDIARELNALLQENTQLT
VPILDALSSLNLSSSLLTEVREAVMATLAAVQLEDLPVVVKFILHSVSASNAYEVVSNLR
QKLELEQCVLPPVLQASQIRMKSKSSAGSASTAAPGNSQDSVTLVLDCIKSAVRFQKTIS
EAWLKAIESVGDIEDHKVLDLLVLFILHCTNANQSRRGAERVLKLKVRTGLMQEALLQKT
FRDYSQVMRGYFPSILALAQSLVRSPDPCVVPFGGQMYRHSFTAFDSYCQQEVVGSLVTH
VCSGVSGEVDVALELLCSLVMEKPSEMALYAVFVKGILDYMDNLTPQQIRRLFHLLSRLA
FGQQQQGSHIQDDMHIVIRKQLSSTVPKYKRIGIIGAVMIVGSMGALRPKGKESQSSSLS
QETLRQVTALLELVKSSSESSPEAAALYYDELANLIWSSALDPQVEEMIGMSVLDDFQDD
FVVDLGPDIAGSFIFPACAMYNLEEDESQGGIAINLLPLLAKETQNKGEQQSQIGKQKQQ
KRVSPLCLSPFFRLLRLCEEKRHQGDLEEIDALVGCPLILTNMDVVDKVDSLSKAEREFI
CTLLFHTINWFREVVNAFCKQKETEMKMKVMTRLQNITFLQTLLERALAGTTGYMPPVSN
FDGETTDGISFGVPVNKGKKDGTGKKRKAPGKNAPEAVSQPEEATEADETQQEQPEKEKE
KENRLGVSLTAYRPFFRELDMEVLSVLQCGLLSRSLLDSELHTKVQEEVVLGPTELVFLL
EDMQHKLEFSLTAAPAKRAPFLKMRADKTVGFSHLQQRSTKDIASYCVQLLPALCSHLEN
CHNHFQTLLSENNGVVDGPSTDVEEHQVMSSGYQLLLQVINTTFSWSGFSQPGQRSLLKK
ALGLLAGRLKEGGPELTLEQLVKHSFEYLLNFRSTMPSLSTALCLSQLLSTVSEKGGNPG
AYREQTASLARRFLNQSWVTASGEKERGSKFNEALHTLLSIYLEHVDDVLKAVEEIAGEG
ITELINTSKDESSASWPTLNRQTFLVFYKVLMAELEKAARRIPAGKMSDSSEAQSEKLLT
WNLAVRDFHILVNLVKVFNSRPVLNVSLKYGRLFLESFLKLGMPLLDYSFKRHKEDVQSL
LKTFQLSTRQLHHMCGHSKIHQDTSLTNHVPAVKKSLELFVYRVKAMLTLNNCQEAFWMG
NLKNRNLKGEEILSQRSQGSDDDDEEEEGDQELPPPQEQSDDEDQEADSEENSRISRKED
STEDSD
NT seq 4341 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcaaaaagcgacactcctctgtggaaaaagtagcgggaacaactgccgccaca
aaggcaaagaagagtcgcaacagtggtcggcagcctaaggacgctgcttcagaggaagca
agtgaaactgcttttgtcacttttgtaaaaaaagccggtgtcgggttgaaacataatggc
gcatcgcatgagatcgctgttgatcaggtggttttccaaaagcgaatacagcagcagctg
cagaaaagccccagataccctgatatcctgaaggagtttataacggatttggaggcttac
attgagaacccggacaggttcaggaactgccttcttccatgtatcccacaactatctgaa
ggagatgtgagatctgtcagctcattccaggaaagcctcatcagaatgttattggggatc
gaaatgctgcagactttgataatcagcaccttacttgagaaactccctgaatttatgttc
gatggcactgtggacggaggactcaatattcctcgtatgattattaaccagctgaaatgg
ctggacagggtcgtggacacaaaggaacttgctgtgaagctgatggagttggtgtcagta
gcaccagttgaggtccagcgtgacatcatcaccagtttgcctgagatactggaagactct
cagcacaatgatatagccagggagctcaatgctttgcttcaggagaacactcagctaacg
gttcccatcctggatgccctctccagtctaaacctctcgtcgtcattactgacggaggtc
cgagaggcggttatggccacactcgccgctgtccagctggaagacctacccgttgtggtg
aagttcatcctgcattctgtctcagcttcgaatgcatatgaagtggtgagcaatctgcgt
caaaagctggaactggagcagtgcgttcttcctccggtgctgcaggcctcacagatccgc
atgaaaagcaaatcatcagcaggatctgcttctacagctgctcctggcaacagtcaggac
agcgttacgttggtacttgactgcatcaagtcagcagtccggttccagaaaactatttct
gaggcttggctcaaggcaattgagtcggtgggtgatattgaggaccacaaggttttagat
ctgctggtgctcttcatcctgcactgcaccaacgccaaccagagccgccggggcgccgag
agagttctgaagctcaaagtgaggactggactcatgcaggaggctctgctgcagaaaacc
ttcagggactactctcaggtcatgcgagggtacttcccctcaatcctggctcttgctcag
agtttggtgcgctcccctgatccctgcgtggtgccttttggtgggcaaatgtaccgccac
tctttcactgcatttgactcttactgccagcaggaggttgttggctcccttgtgacccat
gtgtgcagtggtgtcagtggggaggtagacgtggccctggagctgctctgcagtcttgta
atggaaaaaccctcagaaatggctctctatgctgtttttgtgaaggggatcttggactac
atggacaatctcacaccacagcagatcagaagactcttccaccttctgagcagactggca
tttgggcagcagcagcaaggatctcacatccaggacgacatgcacatagtgatccgtaag
cagctctccagcactgtgccaaagtacaagcgtataggcatcattggcgctgtgatgatt
gtcggcagcatgggagccttgagacctaaaggaaaggaatcacagagcagctctctttcc
caggaaacattaagacaggtgacggctctgctggagctggtgaagtcgagcagtgaaagc
tctcctgaggcagcggctctgtactatgatgaactggccaacctgatctggagttctgca
ctggacccacaggtggaggaaatgattggaatgagtgtcctggatgacttccaggatgac
tttgtagtggaccttggaccagatatagcaggatcttttatctttccagcctgtgccatg
tacaaccttgaagaggatgagagtcagggaggtatcgccatcaacctgttgcctctgctg
gccaaagaaacccaaaataaaggagagcagcaatctcaaattgggaaacagaagcaacaa
aagcgggtgtcccctctctgtctatctccctttttccgcctattgaggctttgtgaagag
aaacggcatcagggagatctagaagagatcgatgccctcgtgggatgtcctctgatcctg
acaaacatggatgtagtggacaaagttgacagcctgtcaaaagctgagagggagttcatc
tgtactttgctctttcacacgatcaactggttcagagaggtcgtgaatgcattctgcaaa
cagaaagaaacggagatgaagatgaaggtgatgactcgcctgcagaacatcacttttctg
cagacgctgttggagagggctctcgcaggaactactggttacatgccacctgtttcaaac
tttgatggagaaactacagatgggataagttttggtgttcctgtgaacaagggaaagaaa
gatggaacgggcaaaaagagaaaggctcctggtaagaatgccccagaagccgtctctcag
cctgaggaggcgactgaagcagatgaaactcagcaggagcaaccggaaaaggagaaggaa
aaagagaaccggctcggtgtcagtttgacagcttacaggccgtttttcagagagctggac
atggaggtgcttagtgttctgcagtgtggtttgttgtcacgctcgctgctggactcagag
ctccacactaaggttcaagaggaggtcgtgttgggccccactgagctggtcttcctgctg
gaggatatgcagcacaaactggagttcagtctcactgccgctccagcaaagagagctccg
ttcctcaagatgagggcggataaaactgtgggattctcacatctgcaacagaggagtaca
aaagacattgcctcgtactgtgtccagctgttgcccgccctctgttcacatctggaaaac
tgccataatcactttcagactctgctgtctgagaacaatggtgttgtggacggaccttca
acagatgtggaggagcaccaggtaatgtcatccggttaccagctgcttctgcaggtcata
aacaccaccttcagttggtctggattcagccagccgggacagcggagcttgttgaagaaa
gcgctgggacttttagctggacgacttaaagaaggaggtcctgaactgaccctggaacag
cttgtcaagcacagttttgagtacctgctgaacttccgcagtacgatgccgagcctgagc
acagctctgtgtctctcccagcttctgtcaactgtttcagagaagggaggaaaccctggc
gcttatagagagcagactgcttccctggcgcgccgtttcctgaaccaaagttgggtgaca
gctagcggagagaaagagcgaggcagcaaattcaatgaggcacttcacacactccttagc
atctaccttgagcatgtcgacgatgttttgaaggcagtggaggaaatagccggagaagga
atcaccgagctgatcaacacatccaaagatgaaagctctgcttcctggcccactctgaac
agacaaacgttcctggttttctacaaagttttgatggccgagctggagaaagctgccagg
aggattcctgctggtaaaatgagcgacagctctgaggctcaaagtgagaagctgctgaca
tggaacctggctgtcagagactttcacatcctagtcaacctggtgaaggtgtttaattcc
aggccagtccttaatgtgtccttaaagtatggacgactttttctggagtcctttctgaag
ttgggaatgccactgctagactacagtttcaagaggcacaaggaggatgtccagagtttg
ctgaagaccttccagcttagcactcgacagctccaccacatgtgtggacattccaagatt
caccaggacaccagcctaactaaccatgtgccagctgtgaagaagagcctggagctgttt
gtgtacagagtgaaggccatgctgacactcaacaactgccaggaggccttctggatggga
aacctgaagaataggaacttaaagggtgaagagattctttctcaaagatcacaagggagt
gatgacgacgatgaagaggaggagggggatcaggaattaccgccaccacaggaacagtca
gatgacgaggaccaggaagctgattctgaggaaaacagtaggatcagcagaaaggaggac
agtacagaagattctgattaa

DBGET integrated database retrieval system