KEGG   Xiphophorus couchianus (Monterrey platyfish): 114136919
Entry
114136919         CDS       T05908                                 

Gene name
ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Brite
KEGG Orthology (KO) [BR:xco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xco03000]
    114136919 (ahrr)
Transcription factors [BR:xco03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    114136919 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 114136919
NCBI-ProteinID: XP_027861129
Position
21
AA seq 682 aa
MIPPGDCMYAGRKRRKPVQKQKPSSANEKSNPSKRHRDRLNAELDRLASLLPFPPDVISK
LDKLSVLRLAVSYLRVKSFFQASQDKPSRKHVTTPASSNPEPRKDSLPLGTTINESSLLL
ESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHIDDRQEFRRQLHWAMC
PPQHQAMSGEPDSQLAAGTSEDFVVSSMFNSPEAGEIPPELSCFLNRCFIARVRCLLDST
SGFLTMQFQGRLKFLHGQKKKSPSGTLVPAQLGLFCIAVPLLLPSITEMKVKNILMRGKN
KGGGIVSPMEHGESGEHLRRHSIGGGMGDMTDPLLFTCPHPGTTQRSHHALWSPLCKDNL
KCSSDSFYGQEEPLNFCKSSVADHKGAAAGLGGGWPMRQRAGPVRAAQGVSYIPSNRLNR
TGQYGKPYLLSPSCHGGRGADVYVSKLYGSSDADAYCVDLVKSENDFGECYEGHMMSEMP
PIKIEHDSDSENGCETYGQTWACRNQATIDRHYGNGAYDPSTGLQLKSETDYYDPQYSPC
QRGKAGISPTYNNAAYPGYAVNSGARLLKCDKDLVSNGDSNQFSPQRLSHSDSLCGNQPV
SLMEPNVYPQKAYMHLDYNKHGAYEFKGHGLIHSIKREPMDSPPWSENGHDVNQSMMGGS
RNVMPCVMTTGHHKSSPYIYMQ
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgatcccacctggagactgcatgtacgcgggcaggaagaggaggaagcccgtccagaaa
cagaagccgtcctctgccaacgagaaaagcaacccgtccaagaggcaccgggacaggctc
aacgccgaactggaccgcctggccagcctgttgccgttccctccggacgtcatctccaaa
ctggacaagttgtccgtgctgcgcctcgccgtctcctacctccgcgtcaaaagcttcttc
caagcgagtcaagacaaaccctccaggaagcacgtcaccaccccagcatcctccaaccct
gaacccaggaaagatagccttcctctgggtaccaccatcaatgaaagcagcctcctcctg
gaatctctaacaggctttgccttggtggtgagcagtgacggcatggttttttatgcttcc
tcaaccattgtggactacttgggtttccatcagactgacgtgatgcaccaaaacgtcttc
gactacatccacatagacgaccgccaggagttcagacgccagctccactgggccatgtgt
cccccacaacatcaggcgatgtctggggagccagatagccagttagcggcgggaacaagt
gaagactttgtcgtgagcagcatgttcaactctccagaagcaggggaaattcccccagag
ctctcctgctttctcaacagatgtttcatagccagagtccgctgtctcttggacagcacg
tctggatttttgacgatgcagtttcagggtcggttaaagttcctccacgggcagaagaag
aagtcgccctctgggacgctggttcctgcccagctgggtctgttctgcatcgccgtgccc
ctcttactgccctccatcaccgagatgaaagtgaaaaatattttaatgcgtggaaagaac
aaaggtggggggattgtctctccgatggagcatggagagagcggggagcacctaaggagg
cattccatcggtggaggaatgggtgacatgacagaccctcttctattcacttgtccccat
ccgggcactacacagcgaagtcaccatgccctctggtcccctctttgcaaagacaacctc
aagtgcagctccgacagcttctatggccaggaggaacccctcaacttctgcaagtcctcc
gtggctgaccacaaaggtgcggccgcaggcctgggcggagggtggcccatgcggcagcgg
gcggggcctgtcagagccgcccagggagtcagctacatcccatccaaccgcttgaacagg
actggccagtacgggaagccctacctcctctcgccgagctgccacggcggcaggggcgcg
gacgtgtacgtgtcgaagctgtacgggtcgtcggacgcggacgcctactgcgtagacctg
gtgaagagcgaaaacgactttggggagtgctacgaaggccacatgatgtccgagatgccg
cccatcaagatagagcacgactccgactcggagaacggatgcgagacgtacggtcaaacc
tgggcctgccgcaaccaggccaccatcgaccgtcactacgggaacggggcgtacgaccca
agcactggtctgcagcttaaatcggaaacggactactacgacccgcagtactccccgtgc
caacgagggaaagcaggaatcagccccacgtacaacaacgccgcctaccccggctacgcg
gtcaacagcggcgctcgtctgttgaagtgcgacaaagacttggtcagtaacggcgactcc
aaccagttcagcccccagagactctctcactcggactctctatgcggcaaccagccggtc
agcctcatggagccaaacgtctaccctcaaaaggcgtacatgcacctggactacaacaag
cacggcgcctacgagttcaaaggtcacggcttgatccactcgatcaagcgggagccgatg
gactccccgccctggtctgagaacggccatgacgtgaaccagtccatgatgggcggctcg
aggaacgttatgccatgtgtgatgaccacgggccaccacaagtccagtccctacatttac
atgcagtga

DBGET integrated database retrieval system