KEGG   Xiphophorus couchianus (Monterrey platyfish): 114137586Help
Entry
114137586         CDS       T05908                                 

Definition
(RefSeq) autophagy-related protein 16-like
  KO
K17890  autophagy-related protein 16-1
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04136  Autophagy - other
xco04140  Autophagy - animal
xco04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114137586
   04136 Autophagy - other
    114137586
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114137586
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114137586
   03029 Mitochondrial biogenesis [BR:xco03029]
    114137586
Membrane trafficking [BR:xco04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    114137586
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    114137586
Mitochondrial biogenesis [BR:xco03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    114137586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 OAF CENP-F_leu_zip
Motif
Other DBs
NCBI-GeneID: 114137586
NCBI-ProteinID: XP_027862077
Position
22
AA seq 255 aa AA seqDB search
MRSWKNHVRSQLLHRDDKEKLPYVGVFNRFSQLADQFEIRTRILEDIQCKSLERAGVEVD
INTKLLQLQLRESEHLADNLSQTVSDVTSVLYVKEAEVQYWQSRVSQHRQEALTLAIAKN
NLKAALLDFEFTMECQSKELVALRLERTKLKEALDQAHRDKEELVQRWIEEKSAEADRLN
KHNDLTQRWQHLGKQLKKHFHGERGKRFTHLLTDATDGAREASQSVIQGVQDSRQEVQIK
TPSLLQKKSGIALES
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaggagctggaagaaccatgtgcgatctcaacttcttcacagagacgataaagaaaaa
ctaccatatgttggcgttttcaatagattctctcagctggcggaccagtttgaaattcgc
acacggattttggaggatattcaatgtaaaagtttggaacgagcaggagtagaagttgac
attaacaccaaactccttcaactccagctgagagaaagcgaacacttggcagacaacctg
tctcaaactgtctctgacgtgacctcagtcttgtatgtaaaagaagctgaggtccaatac
tggcagtcacgcgtgtcacaacaccgccaagaggcccttactctggctatagcgaaaaac
aacttaaaggctgcccttctagattttgagttcaccatggagtgtcagtccaaagagttg
gtggccctgcgcttggagcggaccaaactgaaggaggcactggatcaggcccacagagac
aaagaggaacttgtgcagcgatggattgaggaaaagagtgctgaagcagatcgactgaat
aaacacaatgacttaacgcaaaggtggcaacatctgggcaaacagctgaagaagcacttc
cacggggaaagaggaaaacgctttactcacttactgacagacgctacggatggtgcgaga
gaagcatctcagtcagtcattcagggagttcaagactctagacaggaagttcagataaaa
acaccatctctccttcagaaaaagtctggcatcgccctggaatcttag

DBGET integrated database retrieval system