KEGG   Xiphophorus couchianus (Monterrey platyfish): 114138104Help
Entry
114138104         CDS       T05908                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma-like isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04012  ErbB signaling pathway
xco04020  Calcium signaling pathway
xco04114  Oocyte meiosis
xco04217  Necroptosis
xco04261  Adrenergic signaling in cardiomyocytes
xco04310  Wnt signaling pathway
xco04912  GnRH signaling pathway
xco04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114138104
   04310 Wnt signaling pathway
    114138104
   04020 Calcium signaling pathway
    114138104
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    114138104
   04217 Necroptosis
    114138104
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    114138104
   04916 Melanogenesis
    114138104
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114138104
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114138104
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     114138104
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   114138104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 Kdo Tir_receptor_C RIO1
Motif
Other DBs
NCBI-GeneID: 114138104
NCBI-ProteinID: XP_027862959
Position
22
AA seq 542 aa AA seqDB search
MATLVTSTRFTDEYQLYEELGKGAFSVVRRCVKKSTGQEYAAKIINTKKLSARDHQKLER
EARICRMLKHPNIVRLHESIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCINQI
LESISHIHQHDIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAEQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSVGRQHTSPAATTSTAAMAQEACKTLLNKKSDGVKSQGNSKNSVVS
SSSTKDSSMSSSVPMEAQTTVVHNPADGTKGSTESCNNAEEEEMKGRKARKQEIIKMTEQ
LIEAINNGDFDAYTRICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPVHTTILN
PHVHLIGEDAACIAYIRLTQYMDSQGRPRSCQSEETRVWHRRDAKWLNVHFHCSGAPAAP
LQ
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggccacacttgtaacctccaccaggttcacagacgagtatcagctgtacgaggaactc
ggaaagggggccttctccgtcgtccgccgctgcgtcaagaagtccacgggacaggagtat
gctgctaaaatcatcaacaccaaaaagctctccgccagagatcatcagaaactggagcga
gaggccaggatctgtcgaatgctcaaacatccaaacatagtacgactccatgagagcatt
gcagaggaaggcttccattacctcgtctttgacctcgtaaccggaggggagctgtttgag
gacatcgttgcgagagagtactacagcgaggcggatgccagccactgcatcaatcagatc
ctggagagcatcagtcacatccaccagcacgatatcgtccacagagacctcaagccagaa
aaccttctcctcgccagtaagatgaagggagcagctgtgaagctcgcggatttcggactt
gccatcgaggtgcagggggaccagcaggcgtggttcggtttcgctggaactccaggatat
ttgtcgcccgaggtgttgagaaaggacccgtacggcaagccggtggacatctgggcatgt
ggtgtgatcctctacatcttgctagtgggataccctccattttgggatgaggaccaacac
aaattgtatcaacagatcaaagctggcgcctatgattttccgtccccagagtgggacacg
gtgacccccgaggccaagaatctgatcaatcagatgttgaccattaaccctgccaaaaga
atcactgctgaacaggcgctcaagcatccctgggtctgccaacgctccactgttgcctcc
atgatgcaccgtcaagaaactgttgaatgtctgcgcaagttcaacgccaggagaaaactg
aagggagctattctcacaacaatgctggtatccaggaacttttcagtgggacggcagcac
accagccctgccgccaccaccagcacggcagcaatggctcaggaagcgtgcaaaacctta
ctaaacaaaaagtcggacggcgtgaagtcacaggggaacagtaaaaacagtgtagtaagc
agcagcagcaccaaagacagcagcatgtcatcctccgtgccaatggaagcccagacaact
gttgtacacaacccagcagacggcaccaagggctccacagagagctgtaataacgccgaa
gaggaggagatgaaaggtaggaaagctcggaaacaagagataataaagatgacagagcag
ctaatcgaagccatcaacaatggggattttgatgcttacacgagaatctgtgatcctgga
ctgacttcttttgagccagaagctctgggaaacctggtggagggcatggactttcacaaa
ttctactttgagaatcttctgagtaaaaacagcaaaccagtccacaccaccatcctcaac
ccccacgtgcatctgatcggcgaggacgccgcctgcatcgcctacatccgcctgacgcag
tacatggacagccaggggcggcctcgatcctgccaatcggaagagacccgcgtgtggcat
cggcgcgacgccaagtggctcaacgttcacttccactgttcaggagcaccggctgcaccg
ctgcagtga

DBGET integrated database retrieval system