KEGG   Xiphophorus couchianus (Monterrey platyfish): 114139238
Entry
114139238         CDS       T05908                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04080  Neuroactive ligand-receptor interaction
xco04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    114139238 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114139238 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 114139238
NCBI-ProteinID: XP_027864838
Position
23
AA seq 75 aa
MNVKILTLVIVLLVSLLCPAGAGPMASTEHGRGLEEAATVRKMAQQNPVRGGQTHRPAKR
RRPRPRLSHKGPMPF
NT seq 228 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgtcctgcc
ggtgctggtcccatggcctccacggagcatggcagagggctggaagaggcagctacagtg
agaaaaatggcccagcagaacccagtgagaggcggtcagacccacagaccagccaagaga
agacgcccacggccccgtctttcccacaaggggccaatgccgttctag

DBGET integrated database retrieval system