KEGG   Xiphophorus couchianus (Monterrey platyfish): 114139736Help
Entry
114139736         CDS       T05908                                 

Gene name
pin4
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase NIMA-interacting 4
  KO
K09579  peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 [EC:5.2.1.8]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Brite
KEGG Orthology (KO) [BR:xco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:xco03110]
    114139736 (pin4)
Enzymes [BR:xco01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     114139736 (pin4)
Chaperones and folding catalysts [BR:xco03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    114139736 (pin4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase_3 Rotamase Rotamase_2
Motif
Other DBs
NCBI-GeneID: 114139736
NCBI-ProteinID: XP_027865631
Position
23
AA seq 127 aa AA seqDB search
MPPKGKGGKGGKGAASGSSDADKKEKTPKGGTAVKVRHILCEKHGKCMEAMEKLKAGVRF
SEVATQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALAVSSMDKPVYTDPPVKTKFGYHI
IMVEGKK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgaagggaaaaggtggaaagggtggtaaaggagctgcttcaggaagttcggac
gctgacaaaaaggaaaaaactcctaaaggaggcacagctgttaaggttcggcacattctc
tgtgaaaagcacggaaaatgcatggaggccatggagaaattgaaagctggagttcgtttc
agtgaagtagcaacgcaatacagtgaagacaaagcaagacaaggaggtgacctgggctgg
atgacgcgagggtcaatggtcggacctttccaggaggcagcgtttgctctagctgtcagt
tcgatggataaacctgtctacacagacccacctgtcaagacgaagtttggatatcatatc
attatggttgaggggaaaaagtag

DBGET integrated database retrieval system