KEGG   Xiphophorus couchianus (Monterrey platyfish): 114140370Help
Entry
114140370         CDS       T05908                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1D-like
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    114140370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114140370
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     114140370
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   114140370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo RIO1 APH YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 114140370
NCBI-ProteinID: XP_027865979
Position
24
AA seq 437 aa AA seqDB search
MGRQEGDYAWKKNTENIQEIFEFIEELGSGAFSEVYMVRERKTGKTFAMKCVKKKKKRDI
NLENEIAVLRKIQHDNVVGMEDLYESRTHYYIIMHLVSGGELFDRILDRGVYSEKDASRV
IQQVLEAVSFLHQNGIVHRDLKPENILYYSQDEDSKIMISDFGLSKMAENGIMSTACGTP
GYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYPPFYEESETRLFSKIMKAQYEFDSPFW
DNISESAKDFIRNMMQKNPSMRYTTEQALRHPWIIGKTARSQDIYYSVSSQIQKNFAQSK
WKQAFNAAVAINHMKKLQLAHTELALRQASVPDIKVIDVSSPTKSRKHPDPEKPEAKKED
INGNISETQHMSLPPSHVDLKNHFHPLKASQSQNAAQHAPTMAEQGKHVYHSEPANLNGY
AKNQNGKTVQTGVCSIM
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggggcgccaggagggcgactacgcgtggaagaagaacacggaaaacatccaggagatt
tttgaattcatagaagagttgggatcaggcgcgttctctgaggtctacatggtgagagag
cggaagaccgggaagacgttcgccatgaagtgtgtgaagaagaaaaagaagagggacatc
aacctggagaacgagattgctgtgctgagaaaaatccaacatgacaatgttgtagggatg
gaagatctctacgaaagtcggacgcattactacatcatcatgcatctggtttcgggcggt
gagctgttcgaccgtattctggaccgcggcgtttattcagagaaggacgccagcagggtg
atccagcaggttctggaagccgtcagcttcctgcatcaaaacggcatcgtgcatcgagac
ctcaagccagagaacatcctctattacagccaggacgaagactccaagatcatgatcagt
gacttcggcctgtcaaagatggccgaaaacggcatcatgtccacagcgtgcggcacccca
ggttacgtagctcctgaagttttagcacagaagccctacagcaaggcagtcgactgctgg
tccattggagtaatcacatacatcctactctgtggttatcctcctttttatgaagaaagt
gagacaagactcttttccaagatcatgaaggctcagtatgagtttgactcaccattttgg
gataacatatctgaatctgccaaggatttcatccgtaatatgatgcagaagaaccccagc
atgcgctacaccacagagcaggctctcagacacccctggataatcggaaagacggctcgg
agccaagacatctactactccgtcagctctcagatccagaagaacttcgcccagtccaag
tggaagcaagccttcaacgccgctgtggccatcaatcacatgaagaagctgcagctggcg
cacacagagctggccctgcggcaggccagcgtcccagacatcaaagtgattgatgtgtct
tcgccaacaaagagtcgcaaacatccggatccggaaaaaccagaggccaagaaggaagac
atcaacggcaacataagcgagacgcagcacatgtctctgcccccgagccacgttgatctg
aagaaccacttccacccactgaaggccagtcagagccagaacgccgcacagcacgcgccc
accatggccgagcaggggaagcacgtgtaccactcagagcccgccaacctgaacggatat
gctaaaaaccagaatgggaagactgtacagaccggagtttgctctatcatgtga

DBGET integrated database retrieval system