KEGG   Xiphophorus couchianus (Monterrey platyfish): 114142912Help
Entry
114142912         CDS       T05908                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00232  Caffeine metabolism
xco00983  Drug metabolism - other enzymes
xco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    114142912
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    114142912
Enzymes [BR:xco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     114142912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 114142912
NCBI-ProteinID: XP_027870284
Position
4
AA seq 290 aa AA seqDB search
MNLEDYFQRIGFHGPSDKMDLATLKSIHKLHVMSIPFENLSIHCGEWITMDLETIFNKVV
RSSRGGWCLENNYLFGWVLREMGFNSTILGGRVFNTITNDFPPGENHLINKVIIDGKAYI
ADVSFGVSSQIWEPLELISGKDQPQAAGVFRLTKKEDTWILEKTGRTPKVLNPEFAKSSL
VNRKQTYQIFCFTLQPREPEHFAEKSHTLQTNPASLFTNKSICSLQTPTGFKALIGWTYS
EVTYKPEEGVDLLDMRNITEDELDQILKEQFNVKTQNKMKPANKKVSYTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaatttggaggactacttccaaagaataggcttccatggcccttctgataaaatggat
ctcgcaactttgaagtccatccacaagctgcatgtcatgtcaatcccttttgaaaacctc
agtattcactgtggagagtggatcaccatggacctggagactattttcaataaggtggtg
aggagcagccgtggaggctggtgccttgagaacaactacctatttggatgggtgctgaga
gaaatgggcttcaattccacaatcttgggtggcagagttttcaacactatcaccaatgac
tttccacctggggagaatcatctcatcaacaaggttatcattgatgggaaggcttatata
gcagatgtaagctttggggtctcatctcagatctgggagccgctggagctcatctctgga
aaggaccaaccgcaggcagcaggtgtgtttcgacttaccaaaaaggaggacacgtggatc
ctggagaagacaggcaggacaccaaaggttctcaatccagaatttgccaaatccagcctg
gtgaacaggaagcaaacgtatcagatcttctgcttcaccttgcagcctcgagagccagaa
catttcgcagaaaaaagccacacacttcaaacaaatccagcctctctgttcactaacaag
tccatctgctcgctgcaaacaccgacaggattcaaagctctgattggctggacctacagt
gaggtcacctacaaacctgaggaaggggtggatttgttggatatgagaaacataactgag
gatgagcttgatcaaatcctgaaggagcagtttaatgtaaagacacagaataaaatgaag
cctgcaaacaaaaaggtgtcctacacaatctag

DBGET integrated database retrieval system