KEGG   Xiphophorus couchianus (Monterrey platyfish): 114144943Help
Entry
114144943         CDS       T05908                                 

Gene name
suclg1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial isoform X1
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00020  Citrate cycle (TCA cycle)
xco00640  Propanoate metabolism
xco01100  Metabolic pathways
xco01200  Carbon metabolism
Module
xco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    114144943 (suclg1)
   00640 Propanoate metabolism
    114144943 (suclg1)
Enzymes [BR:xco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     114144943 (suclg1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     114144943 (suclg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 Glyco_tran_WecB
Motif
Other DBs
NCBI-GeneID: 114144943
NCBI-ProteinID: XP_027874009
Position
5
AA seq 324 aa AA seqDB search
MSHSRLFARLLLQQSGVRHCYTGSRKNLYINKNTKVICQGFTGKQGTFHSQQAVDYGSQL
VGGVSPGKGGKTHLGLPVFNSVKEAKEGTGAEATVIYVPPPFAAAAIIEAIDAEIPLVVC
ITEGIPQQDMVKVKHKLLRQSATRLVGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRS
GTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTNFIDCLEVFLEDPKTEGIILIGEIGGNA
EENAAEYLKQHNTGDNAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQSAG
VVVSMSPAQLGSTMFKEFEKRKLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatagcaggttgtttgccaggctgcttttgcagcagagtggagtcagacactgt
tatacagggagcagaaagaacctctacatcaacaagaacacgaaggtcatctgccaaggt
ttcacaggaaagcagggaacatttcacagtcagcaggctgtcgactatggctcacagctt
gtaggaggagtttctcctgggaaaggcgggaagacgcacctcggcctgccagtcttcaac
tcagtcaaggaggcaaaagagggtacaggagccgaagcgactgtgatttatgtacctcct
ccgtttgcggccgccgccatcatcgaggcaatagacgcagagatacccctggtggtgtgc
atcactgagggaatcccccagcaggacatggtgaaagtcaaacataagctcctgcgtcag
agcgccacccgcctcgtaggccccaactgcccaggagtcatcaatcctggagagtgcaag
attggaattatgccgggacatattcacaaaaaaggaagaattggcatcgtttccagatca
ggtaccttgacatatgaagctgtgcatcagactacacaagtgggcctgggccagtccctc
tgtgtgggtattggtggtgatccatttaatggcacaaacttcatagattgtctggaagtg
ttcctggaagatcccaaaacagaggggattatcctcatcggagagatcggaggaaatgct
gaggagaatgctgccgagtatctgaagcagcacaatactggagataacgccaagcctgtg
gtgtcgttcatcgctgggctgacggctcccccaggccgcaggatgggacacgctggtgcc
atcattgctggcgggaagggcggagccaaagagaagatcgcagctctccagtctgctgga
gttgtggtcagcatgtcccctgctcagctggggagcacaatgttcaaggagtttgagaag
agaaaactgttgtaa

DBGET integrated database retrieval system