KEGG   Xiphophorus couchianus (Monterrey platyfish): 114145510Help
Entry
114145510         CDS       T05908                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit-like isoform X1
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04260  Cardiac muscle contraction
xco04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114145510
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    114145510
   04261 Adrenergic signaling in cardiomyocytes
    114145510
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xco04040]
    114145510
Ion channels [BR:xco04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   114145510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 114145510
NCBI-ProteinID: XP_027874938
Position
5
AA seq 334 aa AA seqDB search
MRVCNRGMMMLLTTAGAFCAFSLMTIAVGTDYWLYSRGMCRSKNLNDNETVHKNEEVLTH
SGLWRTCCTEGIFRGVCKDIDHFPDDADYEQDAAEYLLRAVRASSLFPILSVGLLFLGGL
CVAASEFYKSRYNVILTAGILFVSAGLSNIIGIIVYISANSGDPSQSDNKKSYSYGWSFY
FGALSFVLAEMVGVLAVHVFIEKHRQLRTKGRPSLMKPPVSRNSSSYRNRYYYNHSRRYS
YRSNHSTADSTCHGYQTSLLRDQEPSISAESKVTMVAGLPMPMTMGSEFMLYALASPLKK
NKIDLGVEDLTTAALHNTDMLPGNCVSNRRTTPV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagggtttgcaacagggggatgatgatgcttctgaccacagcgggggctttctgtgca
ttcagcctcatgaccattgcagtgggaacggactactggctctactcccgcgggatgtgc
cgctccaagaacctgaacgacaatgagaccgtccacaaaaacgaggaggttctgacccac
tcgggactttggaggacctgttgcactgaggggatatttcgaggtgtttgtaaagacatt
gatcactttcctgatgacgcagactacgagcaggatgctgcagagtatttactaagggca
gtacgagcctccagcctcttcccaatactcagcgtgggacttctttttcttgggggtttg
tgtgtagctgccagtgagttctacaagtctcgctacaatgtcattctcacagctggtatt
ctctttgtctctgcaggtctcagtaacatcattggcatcattgtgtacatatcagccaac
tctggggaccccagtcagagcgacaacaagaagagctactcctacggttggtcgttttat
tttggagctctgtcttttgtgctggccgagatggtgggtgtcctggcagtacacgtgttt
atagaaaagcacaggcagcttcgcaccaaaggccggccctcactcatgaagcctccagtc
tcccgaaactcttcatcataccgcaaccgatactactacaaccacagcagacgctacagc
taccgcagcaatcacagcacagcagactcaacctgccacggttaccaaacatcactacta
cgtgaccaggagccaagcatttcagctgaatctaaagtcaccatggtggctggtctgcct
atgccaatgacgatgggctcagagtttatgctgtacgccttagcttcaccgctaaagaag
aataagattgacttgggggtggaggacttgacaactgcagcccttcacaacacagacatg
ctgccgggaaactgtgtgtccaatcgaagaaccactcctgtctga

DBGET integrated database retrieval system