KEGG   Xiphophorus couchianus (Monterrey platyfish): 114148573Help
Entry
114148573         CDS       T05908                                 

Gene name
pla2g4c
Definition
(RefSeq) cytosolic phospholipase A2 gamma isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00564  Glycerophospholipid metabolism
xco00565  Ether lipid metabolism
xco00590  Arachidonic acid metabolism
xco00591  Linoleic acid metabolism
xco00592  alpha-Linolenic acid metabolism
xco01100  Metabolic pathways
xco04010  MAPK signaling pathway
xco04217  Necroptosis
xco04270  Vascular smooth muscle contraction
xco04370  VEGF signaling pathway
xco04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    114148573 (pla2g4c)
   00565 Ether lipid metabolism
    114148573 (pla2g4c)
   00590 Arachidonic acid metabolism
    114148573 (pla2g4c)
   00591 Linoleic acid metabolism
    114148573 (pla2g4c)
   00592 alpha-Linolenic acid metabolism
    114148573 (pla2g4c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114148573 (pla2g4c)
   04370 VEGF signaling pathway
    114148573 (pla2g4c)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    114148573 (pla2g4c)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    114148573 (pla2g4c)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    114148573 (pla2g4c)
Enzymes [BR:xco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     114148573 (pla2g4c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B Patatin
Motif
Other DBs
NCBI-GeneID: 114148573
NCBI-ProteinID: XP_027879744
Position
7
AA seq 582 aa AA seqDB search
MQTRRGNTGFSLGLGFCFCLVISGVALQAVDNMEGNMTASEETIRHSSALCAGEQQYIDR
RKEIVLQALNNLQINCNADLVPHIALVASGGGQRAAVSLIGFLYQLEKEAMLDTLLYIGG
VSGSTWSMAFLYNDPQWSSNMDEAVSKLSGPGVELEHAVAWLTEKSKEEDFSLTDIWGVL
TSAGIMKQMDKRRLSEEVSRNATNPYPVYCALEKHCYSHGPLQGKWFEVSPHEAGFTELN
LFVETSLLGSKFHNGELMEKKPEMDMISLQGVLGCALAHEEVIRDVIPPWLNGPTDDVTK
EYLRVYNVLRNLITLTSSTIQDPTALSELDKLQKILHDKVHHNESVLLESLSPEERKNLF
QQWSLGLVRTVEIWGQSLEDGAFKTSVSFITKQVLPLILKWEWGTTSNFLYQFQNDSVPD
CLQTKEEFHLIDAGLLINMAYPSFLGEKRDIDLIIAPESSAGIMFETLILARNYAAEVNK
PFPPIDNKILEESDWPKNCYVFEGKEKEPTIIYMPLFNQQNCKDAEEVKAKMKEFSTFTL
PFSQEKINFLLETAKTNMKNNREIVLRELRKAALRRMRKMSV
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgcagacacgaagaggaaatacaggtttttctttaggcttggggttttgtttttgcctg
gtgatttccggagttgcactgcaggcagtggacaacatggagggaaacatgacagcttct
gaggaaaccatccgtcactcctcagctctgtgtgctggagaacaacaatatattgacagg
agaaaagaaattgttctacaggcattgaacaatctgcaaatcaactgtaatgcggattta
gtccctcacatcgccctggtggcttctggtgggggtcagagggcagctgtgagtctcata
ggcttcctgtatcagctggaaaaggaagccatgctggacactttgctctacataggagga
gtttctgggtcaacatggtccatggccttcctgtacaatgaccctcagtggagctccaac
atggatgaagcggtgtccaagctgtcgggtcctggggtggagctggagcacgctgtggcc
tggttgactgaaaagtccaaggaggaggatttctctctcactgacatctggggggttcta
acctctgccggcatcatgaaacagatggataaacggcgtctttcagaggaggtcagcagg
aacgccaccaacccttaccccgtctactgtgctctagagaaacactgctactcacatggg
ccgctacaaggtaaatggtttgaggtgagccctcatgaggcaggattcacagagttgaac
ctctttgttgaaacgtcactgttgggcagcaagtttcacaacggggagctgatggagaag
aaaccagagatggacatgatcagtctacagggagttttaggctgtgcactggctcatgag
gaagttatcagggatgtgatccctccctggcttaatgggcccacagatgatgtgaccaag
gaatacctgcgtgtgtacaacgtgctcagaaacttgataactctcacctcaagcaccatc
caggatcctactgccctgtctgagcttgacaagttgcagaaaatcctacatgacaaggtg
catcataatgagtcagttctgctggagtcgctgagtccagaagaaagaaaaaatctgttc
caacagtggagtcttgggttggtgaggacagtggagatctggggccaaagtttggaggat
ggagctttcaaaacatcagtttctttcattacaaagcaagtccttcctcttattttgaag
tgggagtggggaacaaccagcaacttcctctatcagttccagaatgattcagttcctgat
tgtctccagactaaagaagaattccacctgatcgatgcagggctgctgatcaacatggcc
tacccgtcattcctaggagagaagagagacatcgacctcatcattgcaccagagtctagt
gctggaattatgtttgagactctgattcttgccaggaactatgcagctgaagtgaataaa
cccttccccccgatagataataaaatcctggaggagagcgactggccgaagaactgctac
gtgtttgaggggaaagaaaaggagccgaccatcatctacatgccgcttttcaaccagcaa
aactgcaaagatgcagaggaggtcaaagcaaagatgaaggagttctccaccttcacgctg
cccttcagtcaggagaagattaacttccttttggagacggccaaaactaacatgaagaac
aacagggagattgtgctgagagagttgaggaaagctgctcttcgtcgcatgaggaagatg
agcgtatga

DBGET integrated database retrieval system