KEGG   Xiphophorus couchianus (Monterrey platyfish): 114148813Help
Entry
114148813         CDS       T05908                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4-like isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114148813
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114148813
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114148813
Protein kinases [BR:xco01001]
 Serine/threonine kinases: STE group
  STE20 family
   114148813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 114148813
NCBI-ProteinID: XP_027880089
Position
7
AA seq 1488 aa AA seqDB search
MANDSPAKSLVDIDLASLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNSLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYTQRPPTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTKKKRGEKDETEYEYSGSEEEEEEASEQEGEPSSIVNVPGESTLRRDFIRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREMR
RQQEREQRRREQEEKRRIEEMERRRKEEEERRRAEEEKRRADREQEYIRRQLEEEQRHLE
ILQQQLLHEQAMLLEYKWRELEEQRQAQKLQRQLQQEQTYLLSLQQNQNPDSSKTSQQQS
AKPPQSLEADRVKPPQMPDPDAQKQPQGVSNEKTRPGPEKTTEPKLPAAEQQGPAPDSEP
VREADERYRKNIQGSPQSAQTKPQQPPVPPRSESSHANGNAASEAPAMHRPVEPQVRSHL
AALKSSSSVASPNSSAATPPVMSRSHSFTEPLTPSFENYHPHKSHEPHQHHHPASSSSSP
SFLPSAPARTEPQTHPQSRPMPHEKVPSEDGPPRVPVRTTSRSPVLSRRDSPHHHSNAPQ
SRDMLRNAGSSAEPRLLWERVEKLVPKTSGSSGSGGSSSSSSSSNSSSQCDSGERFRARS
SSKSEGSPLQRPENAGKKPEERRDLVRPNKPADLTALAKELRAVDDVRPQNKVTDYSSSS
EDSDTTDEDDDEEVDQEAGEESTSGPEDSKAVSSKLSNGETESVKTMIVHDEGENEAGTT
RCKDSTLVVRQSAGDNRKRTAPTSGQTQTLSLLAGFPPSPGSAPAQGLIFHTPSPPHQHH
HHHHHHHHPTQHPDRNGFAGRIHHLPDLIQQSHHSSPSSSASSSPSSSSLASPSAMSPQS
PLEKLGILAESQSSNNMQKHKSSSSFTPFIDPRLLQVSPSTGSALNNVGYANDARLAEAL
RADPSRKGSVVNVNPVNTRPQSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLD
RSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKK
QGWTTVGDLEGCVHYKVVKYERIKFLVLALKNSVEVYAWAPKPYHKFMAFKSFGDLVHKP
LLVDLTVEEGQRLKVIYGSCSGFHAVDVDSGAVYDIYLPTHIQNNIQSHAIIILPNTDGI
ELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQIMGWGEKAIEIRSVETGHL
DGVFMHKRAQRLKFLCERNDKVFFASVRPGGSSQVYFMTLGRSNLLSW
NT seq 4467 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgactctccggctaagagcctggtggatatagacctggcatcgttgagggat
ccagctgggattttcgagttggtggaagtagtggggaatggcacctatggacaagtgtat
aagggtcgacatgttaagacgggacagctggctgccatcaaggtcatggacgtcacagag
gatgaagaggaggaaattaagctggaaatcaacatgctgaagaagtattcacaccacaga
aatatagccacatactacggcgctttcatcaagaaaagtccaccgggccacgatgaccaa
ctctggcttgtcatggagttctgtggcgctggctcaatcaccgatctggtgaaaaacacc
aaaggaaactcactgaaggaggactggatcgcctacatctctagagagatcctcagggga
ttagctcacttacacgctcatcatgtgatccaccgtgacatcaagggacaaaacgtgctg
ctcactgaaaacgctgaagtcaaactggtggattttggtgtgagcgctcagctggaccgg
acggtgggccgaaggaacaccttcatcgggacgccctattggatggctccggaggttatc
gcctgtgacgaaaaccccgacgccacctacgactacaggagcgacctttggtcctgtggc
atcacagccatagagatggcggagggagcgccccctctgtgtgacatgcatccgatgaga
gccctcttcctcatccccaggaatcctcctcctcgactgaagtccaaaaaatggtcgaag
aagttcttcagcttcatcgagggctgcctggtgaagaactacacccagcggccccccact
gagcagctgctgaagcaccccttcatccgggaccagcccaacgagaggcaggtccgcatc
cagctcaaggatcacatcgacagaaccaagaagaagaggggcgagaaagatgagacagag
tatgaatacagtgggagtgaagaagaggaggaggaagcttctgagcaagaaggagagcca
agctccatagtcaacgttccgggcgagtcgacattgcgccgcgacttcatccggctgcag
caggagaacaaggagcgctccgaggccctgcgccgccagcagctcctccaggagcagcag
ctccgtgagcaggaggagtacaagcgccagctgctggccgagaggcagaaacgaatcgag
cagcagaaggagcagcgcaggcggttggaggagcaacagcggcgcgagcgcgagatgagg
aggcagcaggagcgcgagcagcgccgacgggagcaggaggagaagaggcgcatcgaggag
atggagcgccgtcgcaaagaggaggaggagcgaaggagggcggaggaggagaagaggagg
gccgaccgagagcaggagtacatccggcgtcagctagaggaggagcagaggcacctggag
atcctgcagcagcagctcctccacgaacaggccatgcttcttgagtataaatggcgggag
cttgaggagcagcggcaggctcagaagctccagaggcagctgcagcaggagcagacctac
ctgctgtcactgcagcagaaccagaacccggacagtagcaaaacaagccagcagcagagc
gccaaacccccgcagagcctcgaagccgacagggtaaagcccccgcagatgcccgacccg
gatgcacaaaaacaaccgcagggcgttagcaatgagaagacgcggcccggaccggagaaa
acgacagaacccaaacttcctgcggctgagcaacaaggccccgcacctgactctgagccg
gtcagagaggccgacgagcggtacaggaagaacattcagggttccccgcagtcggctcag
accaaaccccagcagcccccagtgccgccgcgctccgagtcttcgcacgctaacgggaac
gccgcatcggaggcgcccgcgatgcaccggcctgtggagccgcaggtccgttcccatctg
gctgctctcaagagcagcagcagtgtggcctcgccaaactcatctgctgcaaccccaccc
gtcatgtcccggtcgcactccttcaccgagccgctaacacctagctttgaaaactaccac
ccacacaaaagccatgaaccccaccaacaccatcatcctgcatcctcctcgtcatcgccg
tcattcttaccatcagcgcctgcacgcactgagccacaaacccatccccagtccagaccc
atgccccatgaaaaggtcccgtcagaagacggcccgccgagggttcccgtcaggacaaca
tcaaggtctccggtgttgtcgaggcgagactcgcctcatcaccatagcaacgccccacag
agcagggacatgctccgaaatgctggcagttcggcagagccgcggctcctgtgggaacgc
gtggagaaactggttcccaaaacgagcggtagtagcggcagcggaggctccagttcctcc
agcagctccagtaactccagctctcagtgcgactctggagagaggttcagggcccgctct
tcttccaaatcggagggctcgcccctccagcgaccagagaatgctgggaaaaagccagag
gagaggagggacttggtcaggccgaacaaaccagcggacctgaccgctctggccaaggag
ctgcgtgcagtagacgatgttcgtccccagaacaaggtgacggattattcgtcctccagc
gaagactcggacaccaccgacgaagacgacgacgaagaggtggaccaggaggcaggcgaa
gagtcgacgtctggcccagaggactccaaagctgtctcttccaagctgagcaacggcgag
acggagtcggtgaaaaccatgatagtccacgacgagggcgagaacgaagcaggaacgact
cgatgcaaagacagcacgctggttgtcagacagagcgcaggtgacaacagaaagcgcacg
gcccccacgtcgggccaaacgcagacccttagcctgctcgcgggcttccctccgagcccc
ggctcggcgcctgcgcagggactcatcttccacacccccagccccccacaccaacaccac
caccaccatcaccaccaccatcaccccacgcagcaccctgaccggaacggctttgccggc
cgcatccatcacctcccagacctgatccagcagagccaccactcctccccttcctcctct
gcatccagctccccttcttcttccagccttgccagtccctccgccatgtccccccagagc
ccgctggagaagctcggcattctggcagagagccagtcgagtaacaacatgcagaaacac
aagtcctcttcgtctttcacgccgttcattgacccacgcctcctccaagtgtctccatcg
actggcagcgccctcaacaatgtcggctacgcgaacgacgcccggctggcggaggcgctg
agggccgacccgtcccggaaaggctctgtggtcaacgtcaacccggtcaacacccgccct
cagagcgacacgccggagatccgcaagtacaagaagaggttcaactccgagatcctgtgt
gccgcactttggggcgtgaacctgttggtgggaacagagagcggcctgatgctgctggat
cgcagcggtcaggggaaagtttaccctctgatcaaccggcggcgcttccagcagatggac
gtcctcgagggactcaacgtcctcgtcactatatcaggtaaaaagaacaagctgcgtgtc
tactacctatcctggctgaggaacaagatccttcacaacgaccctgaggtggagaagaaa
cagggctggaccaccgtaggggatctggaaggctgtgttcactacaaagttgtaaaatat
gagaggatcaagttcttggttctggctctgaagaactcggtggaggtctacgcctgggcg
cccaaaccctaccataagttcatggccttcaagtctttcggtgacctggtgcacaagccc
ctgctggttgacctcactgtggaggaagggcaaaggttaaaggtcatctacggctcctgc
tcaggcttccacgccgtcgacgtcgactccggtgcggtctacgacatctacctgccaacc
cacatccagaacaacatacagtctcacgccatcatcatcctccccaacaccgacggcatc
gagctgctggtgtgctacgaggacgagggggtttacgtcaacacctacgggcgcatcacc
aaggacgtggtgctgcagtggggggagatgcccacctcagtggcctacattcgctccaac
cagatcatgggctggggcgagaaggccatagagatccgctcagtggagactggtcacctg
gatggagtctttatgcataagagagcccagagactcaagttcctctgcgaaagaaacgat
aaggtgttcttcgcctccgttcggcccggaggctccagccaggtctacttcatgactctg
ggccgaagcaaccttctcagctggtag

DBGET integrated database retrieval system