KEGG   Xiphophorus couchianus (Monterrey platyfish): 114149304Help
Entry
114149304         CDS       T05908                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like isoform X1
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04020  Calcium signaling pathway
xco04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    114149304
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114149304
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xco04030]
    114149304
G protein-coupled receptors [BR:xco04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    114149304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 TRAP_alpha TMEMspv1-c74-12
Motif
Other DBs
NCBI-GeneID: 114149304
NCBI-ProteinID: XP_027880853
Position
8
AA seq 432 aa AA seqDB search
MATASPPHFLDDVINDGQQQQEQQEFLSSLETVFLTIFLSVIIILTMFGNLLVMVALCKD
RHLRRKKTSYFIVSLAFADLLVALLVMPFAAIELTTGQWHFGEIFCLVRTSLDVLLTTAS
ILHLCCIALDRYYAICCQPLVYRYKMTPVRVALMLIGCWVIPTFISFLPIMQKWNTIGIE
DIIEEKQSLSGGSNTSCVFLVNQPYALICSAVAFYVPLALMVLAYQRIYVTAMIHVRQIE
TLHRAGSFPPTHSDQVMTIQSSNSSDPRNHYRLRTATGLLSSEQSQRRHRRMRIETRAAK
TLAIIMGCFSLCWAPFFITNVVDPFIHYSVPWQVWTAWLWLGYINSGLNPFLYAYLNQAF
RRAFLVILCCGDDRYTQQGTCSTGFHRPSSVQSVNGTSMALRLSFLPNRSYSDNGQTILA
IEQESQDSLGPL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcatcacctccacattttttggacgacgtaataaatgatgggcaacagcag
caggagcagcaagaattcttgagctctttggagacggtttttctcaccatcttcctctcc
gtcatcattattttgactatgtttggcaacctgttggttatggttgctctctgcaaggac
aggcatctgagaagaaaaaagaccagctacttcatcgtctctctggcttttgctgacctg
ctggttgcgctgcttgtgatgccctttgctgccatcgagctaaccactggccagtggcac
tttggagaaattttctgcctggtgcgaacctctctggatgttttattgaccacggcatcc
atccttcacctctgctgcattgcactggacagatattacgccatctgctgccagccgctg
gtctacagatataagatgaccccagtcagagtggcacttatgctcatcggttgctgggtc
atccccacatttatctccttcctacccatcatgcaaaagtggaacactattggtatagag
gacattattgaagagaagcaatccctttcgggaggctccaacacaagttgtgtgtttctg
gtcaaccagccttacgccttgatctgctctgctgtcgccttctacgtgccgctggccctc
atggttttagcctatcagcgcatctatgtcactgccatgatccatgtcaggcagatagag
actcttcaccgtgccggctcctttccgcctacacattcggaccaggtcatgaccatacag
tcttccaactcctcggatccacggaatcactaccgcctgaggacagcaaccgggctcttg
tcctcagaacagtctcaaagaagacacagacgcatgcgcattgagacgagagcagcaaag
acactggcgatcataatgggctgcttctccctgtgctgggcgccatttttcatcacgaat
gtggtggaccccttcatccattactctgtaccctggcaggtttggacagcctggctgtgg
ctggggtacattaactcaggattgaaccccttcctgtatgcctacctgaaccaggctttt
cgaagggcgttcctcgtgattctttgctgcggagacgaccgttacactcagcagggcacc
tgctccacaggcttccacaggccatcctccgtccagtcagtcaatgggacctccatggct
ctgagattgtccttcctgccaaacagaagctacagcgataatggccagacaatccttgcc
atcgaacaagagtctcaggactctcttgggcccctgtga

DBGET integrated database retrieval system