KEGG   Xiphophorus couchianus (Monterrey platyfish): 114149491Help
Entry
114149491         CDS       T05908                                 

Gene name
acads
Definition
(RefSeq) short-chain specific acyl-CoA dehydrogenase, mitochondrial
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00071  Fatty acid degradation
xco00280  Valine, leucine and isoleucine degradation
xco00410  beta-Alanine metabolism
xco00640  Propanoate metabolism
xco00650  Butanoate metabolism
xco01100  Metabolic pathways
xco01200  Carbon metabolism
xco01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    114149491 (acads)
   00650 Butanoate metabolism
    114149491 (acads)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    114149491 (acads)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    114149491 (acads)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    114149491 (acads)
Enzymes [BR:xco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     114149491 (acads)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 Acyl-CoA_ox_N
Motif
Other DBs
NCBI-GeneID: 114149491
NCBI-ProteinID: XP_027881202
Position
8
AA seq 405 aa AA seqDB search
MSALFKARKVIDFCLHGSRSLSQLAELPETHQLLRQTCRDFADRELAPIAAKLDKEHFYP
AKQVKELGAMGVMAIEVPEELGGAGMDYLAYSLAMEEISRGCASTGVVVSVNNSLYIGPI
LKFGTEEQKKQWISPFTAGDKVGCFALSEPGNGSDAGAASTTAHQDGEEWVLNGTKAWIT
NCWDASATVVFATTDKKLKHKGISAFLIPMPHPGLSLGKKEDKLGIKASSTANIILEDCR
IPLNNMLGPRGAGFKIAMQTLDSGRIGIASQALGIAQASLDCAADYAHKRTAFGAPIGKL
QAIQFKLADMAVAIESARLLTWKASLLRDAKKAFTKEAAMAKLAASEAATFCSHQAIQIL
GGMGYVTDMPAERHYRDARITEIYEGTSEIQRLVIAGQILKEYQS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcactttttaaagctagaaaagttatagacttctgtctccatggcagccgcagt
ctgtcccagctggccgagttgccggagacgcatcagttactgaggcagacctgcagagac
tttgcagacagagaactggcccccattgctgccaagctcgataaggagcatttttaccct
gctaagcaggtaaaggagctgggggcgatgggtgtgatggccatcgaggtgccagaggag
ctgggtggagcggggatggactacctggcttacagcctggccatggaggaaatcagccga
ggctgcgccagcacgggcgtggtggtctccgttaacaactctctatacatcgggcccatc
ctgaagtttggcacagaggaacagaagaagcagtggatcagcccgttcactgctggagac
aaggtcggctgcttcgccctcagcgagccaggaaacgggagcgatgcgggcgctgcctcc
accaccgcccatcaggacggagaggagtgggtgctgaacggaaccaaagcctggatcacc
aactgctgggacgcctcggctacggtcgtgttcgccaccacggacaagaagctcaaacac
aagggaatcagtgccttcctgatccccatgccgcaccctggactctctctgggaaaaaag
gaggacaagctgggcatcaaggcctcgtccaccgcaaacatcatcctggaggactgcagg
atcccactgaacaacatgctggggccccgcggcgccggattcaaaatcgctatgcaaacc
ctggacagcgggcggatcggcatcgcgtcccaggctctcggcatcgctcaggcgtcgctg
gactgcgccgccgactacgcacacaagaggaccgccttcggagcgcccattggcaagctg
caagccatccagtttaaactggctgacatggccgtggccatagagagcgcccgcctgctc
acctggaaagcttcactcctccgagacgcgaagaaagccttcaccaaggaagcagccatg
gccaaactggcggcgtctgaggccgccactttctgctcccatcaggccatccagatcctg
ggcgggatgggctacgtgacggacatgcccgccgagagacactaccgcgacgcccgcatc
acagagatctacgagggcaccagtgagatccagaggctggtcatcgccggtcagatcctg
aaggaataccagtcatag

DBGET integrated database retrieval system