KEGG   Xiphophorus couchianus (Monterrey platyfish): 114149637Help
Entry
114149637         CDS       T05908                                 

Definition
(RefSeq) L-amino-acid oxidase-like isoform X1
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00250  Alanine, aspartate and glutamate metabolism
xco00270  Cysteine and methionine metabolism
xco00280  Valine, leucine and isoleucine degradation
xco00350  Tyrosine metabolism
xco00360  Phenylalanine metabolism
xco00380  Tryptophan metabolism
xco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xco01100  Metabolic pathways
Module
xco_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    114149637
   00270 Cysteine and methionine metabolism
    114149637
   00280 Valine, leucine and isoleucine degradation
    114149637
   00350 Tyrosine metabolism
    114149637
   00360 Phenylalanine metabolism
    114149637
   00380 Tryptophan metabolism
    114149637
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    114149637
Enzymes [BR:xco01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     114149637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox Pyr_redox_2 FAD_binding_2 DAO HI0933_like FAD_oxidored AlaDh_PNT_C Thi4 FAD_binding_3 MCRA Lycopene_cycl GIDA 3HCDH_N NAD_binding_7 NAD_Gly3P_dh_N Trp_halogenase Pyr_redox_3 FMO-like TrkA_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 114149637
NCBI-ProteinID: XP_027881465
Position
8
AA seq 551 aa AA seqDB search
MPRAPTTYHTFPLTEVSVSSLTVTTHSRGRRSKLWSSALQMMPHMVLCKYVPLVLVGVVV
LAASGIIGDPLYECLQDADYRELLDIVTDGLPAARMPQHVAVIGGGMAGLTAAKVLEDAG
HKVTIIEASERIGGRVETFRNRREGWYAEMGAMRIPSFHKILLSFISKLKIPLNSFIQDD
INTYYLVNGGLHKTYTVENNPSVLNYSLHDREKGKSAAELFSQTLWKVRDDLKTLGCSGM
LKKYDSYTVKEYLVKEGNLSRGALRMIGDILNENSLFYTSLIEMLYIQTDINDNTQYFEV
TDGFDQLPTAFYQVLNATILLNSKVKLIDQTDGANVTVTYEDWRNSGSLSKVTVDYALVT
ATAKATLFIDFYPPLSGNKMEALRSVHYASSTKVVLSFKERFWEKEGIRGGKSITDRPSR
FIYYPSHAFPGTTAGALLASYTCSDDSTLFQGMNEEDLMAVALEDLVKIHGEYIRPLCTG
GLVKKWGLDPYSFGAFALFMPYQQGHYARELFQSEGRVHFAGEHTATPHGWIETAMKSAL
RAAKNINNLTL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcccagggctccaactacttaccatacgtttcctttgacagaggtttctgtttcctct
ctgaccgtcaccacacacagcagagggaggaggtccaaactgtggagttctgctctccag
atgatgcctcacatggttctgtgcaagtacgttccgctggttctagtgggagttgtggtt
ttggcagccagcggaatcataggagaccctctctatgagtgtctccaggacgctgactac
agagagctcctggacattgtgacggatggactcccagctgccaggatgcctcagcatgtg
gcagtcatcggcgggggcatggctggactgactgctgccaaggtcttagaagatgcagga
cataaggtgaccataatagaagctagtgagcgaatcggaggacgggtggaaaccttcagg
aacagaagagaaggctggtacgcagagatgggagccatgaggatccccagcttccataaa
attctactttcctttatctccaaattgaaaatcccactgaattccttcatccaagatgac
atcaacacctactacttggtaaacggaggcctacacaaaacctacaccgtagaaaacaat
cccagcgtgctcaactacagtttgcatgacagagagaagggaaagtcagctgctgaactc
ttcagtcagacactctggaaggtgagggatgacctaaagacattgggctgcagtggaatg
ctgaagaaatatgactcctacacagtgaaggaatatttggtgaaggagggcaacctgagc
cgcggcgctttgagaatgattggtgacatcctcaatgaaaacagcctcttctacacgtcc
ttgatagagatgctctacatacagaccgacatcaatgacaacacacagtactttgaagtg
acagatggttttgaccaactccccacagctttctatcaagttttaaatgccacaatcctg
ctgaactccaaagtgaagcttattgaccaaacagatggggctaatgtgactgtaacgtat
gaagactggcggaactcaggttccctgtcaaaagtgacagtggactatgcccttgttacg
gccacagccaaggccaccctcttcattgacttctaccctcctctgtctggtaacaagatg
gaggccctgcgctctgttcattatgccagctccacaaaggtagtgctcagtttcaaggaa
cgcttttgggagaaagaaggcatcagaggagggaaaagcatcaccgaccgaccatctcgc
ttcatctactatcccagccatgcgttcccaggtaccactgcaggggccctcctggcttcc
tacacctgctccgatgactccaccctttttcaaggcatgaatgaggaggatctgatggca
gtagctctggaggacttggtgaaaatccatggggagtatatccgaccgctctgcacgggg
ggtctggtgaagaagtggggcctggacccttacagctttggagcctttgccctgtttatg
ccgtaccagcagggacactacgcgcgagaactgttccagagtgagggacgggtgcacttc
gccggggaacacacagcaactcctcacggttggatcgaaactgccatgaagtctgctctc
agagcagctaagaatatcaacaacttgactctgtag

DBGET integrated database retrieval system