KEGG   Xiphophorus couchianus (Monterrey platyfish): 114150793Help
Entry
114150793         CDS       T05908                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV-like
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04020  Calcium signaling pathway
xco04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    114150793
   04020 Calcium signaling pathway
    114150793
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114150793
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     114150793
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   114150793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo YrbL-PhoP_reg PACT_coil_coil
Motif
Other DBs
NCBI-GeneID: 114150793
NCBI-ProteinID: XP_027883295
Position
9
AA seq 479 aa AA seqDB search
MPTSRPGSEPVEFWVDGSRRDGTVEDFYGLGSELGRGATSIVYRCEEKQTQKPFAVKVLK
KTIDKKIVRTEIGVLLRLSHPNIIQLKEIFETDTDIALVLELVTGGELFDRIVERGYYSE
RDAAHVIKQILEAVAYLHGNGVVHRDLKPENLLYADLSLDAPLKIADFGLSKIIDDQVTM
KTVCGTPGYCAPEILRGNAYGPEVDMWSVGVILYILLCGFEPFFDPRGDQYMYSRILNCD
YEFVSPWWDEVSLNAKDLVSKLIVLDPHKRLSVREALQHPWVLGKAARFSHMDTTQRKLQ
EFNARRKLKAAMKAVVATSRMHEGSRRRTDSCEMPGSGTSRQSSMQQDPPPESAGSAPDE
NEAPPPDQQVPQNDESTLANQSAASPSPPCSPNPPSSEAPPTGPALVRPPLRADGLRQSS
VIPRSMLVQPRPPQKSCSVIESVHRGEATPPLGSPSSPNNLSNGFTPGAEPGTKAAPCQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgccgacctcccggcctggttcggagccggtggagttctgggtggacgggtcgaggcgg
gacgggacggtggaggacttctacggcctgggctccgagctgggcagaggagcgacatcc
atcgtgtaccgctgtgaggagaagcagacgcagaaacccttcgcagtcaaagtcctgaag
aaaacgattgataagaaaatcgtacgcactgagatcggagtcctgctgcgtctttcccac
ccaaacatcatccagctgaaggagatctttgagacagacaccgacatcgccctggttctg
gagctggtgaccggcggagagctgtttgaccggattgtggagcggggatactacagcgag
agagacgcggcgcatgtcatcaagcagatcctggaagccgtggcctatttgcacggtaac
ggggtcgtccatcgtgacctgaagccggagaacctgctgtacgccgacctgtcgctggac
gcgccgctcaagatcgccgacttcggcctttccaaaatcatcgacgaccaggtcaccatg
aagacggtctgcgggactccgggttactgcgctccagagatcctgcggggaaatgcctac
ggccccgaggtggacatgtggtcagtgggcgtcatcctgtacatcctgctctgcggcttt
gagccgttctttgacccgcgaggcgaccagtacatgtacagccgtatcctgaactgcgac
tacgagtttgtgtctccctggtgggacgaagtctccctcaacgccaaggacctggtcagt
aagctgattgttctggaccctcacaagcgcctcagcgtccgggaggccctgcagcacccc
tgggttctgggcaaggccgcccgcttctcccacatggacacgactcagaggaaactgcag
gagttcaacgctaggcgcaaacttaaggctgccatgaaggctgttgtagccaccagcagg
atgcacgaaggatcccgacgccgcaccgacagctgcgagatgcctggctcagggacttcc
aggcagagcagcatgcaacaagacccacctcccgagtcagcaggctccgcccccgatgaa
aatgaggccccgcccccagaccagcaggttccccaaaacgacgagtccacgctggccaat
cagagcgcagccagtccctcccctccctgtagccctaacccccccagctctgaagctcca
cccacaggccccgcccttgtcagaccgccactgcgcgccgacggcctccgacaatcgtcg
gtcatccccaggtcgatgctggtccaaccccggccgccgcagaagagctgctccgtcatc
gagtcggtccacagaggcgaggccacgccgccgctgggctcgccttccagtcccaacaac
ctcagcaacggcttcacgccgggggcggagcctggcaccaaggccgccccctgccagtga

DBGET integrated database retrieval system