KEGG   Xiphophorus couchianus (Monterrey platyfish): 114151874Help
Entry
114151874         CDS       T05908                                 

Gene name
zdhhc16
Definition
(RefSeq) palmitoyltransferase ZDHHC16
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Brite
KEGG Orthology (KO) [BR:xco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    114151874 (zdhhc16)
Enzymes [BR:xco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     114151874 (zdhhc16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Ni_hydr_CYTB CopD
Motif
Other DBs
NCBI-GeneID: 114151874
NCBI-ProteinID: XP_027885161
Position
10
AA seq 365 aa AA seqDB search
MRLGSSWRWQLSRAMRLVLRLALRLRRLCRPQEGGGGVGVRLSAAWRYGKLLLRSLYYNS
LTNSDTLLDCAFEPVYWIVDNVTRWFGVVFVCLVVLLTSSVVIIIYLFVLPTIFSSYPAH
WIAWHLCCGHWLLILVVFHYYKATTTSPGHPSKDKRDVPSVSICKKCITPKPPRTHHCSI
CSLCILKMDHHCPWLNNCVGHLNHRYFFSFCLYMTLGCVYCSVSSRNLFLDAYSAIETSF
QTPPPDLSPRESVGHKCIIFLWVLTSSVAVALGGLTLWHAKLISRGETSVERHINRKEAR
RLQGNGKVFRNPYHHGRLNNWKLFFGVETRSHWLTRVLLPSSHPPGGDGLLWDRPSTSSD
GPMAI
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgggcagcagctggaggtggcagctctcccgagccatgcggctggtgctgcgg
ctggcgctgcgcttgcgccggctgtgtcgcccgcaggaaggaggaggtggggtcggggtc
aggttgtcggcggcgtggaggtacggcaagctgctgcttcgctccctttactacaacagc
ctcaccaactcggacacgctgctggactgcgcgttcgagccggtctactggatcgtggac
aacgtcacccgctggtttggagtggtgtttgtgtgcctggtggtcctgctgacgtcctct
gtggtgatcatcatctacctgtttgtcttaccgaccatcttctcctcgtaccccgctcac
tggatcgcctggcatctctgctgcggccactggctgctcatcctggtggtcttccactac
tacaaggccaccaccacctcccccggacacccatccaaggacaaacgcgacgttccgtct
gtttccatctgcaagaaatgcatcacccccaaaccgccgaggacgcaccactgcagcatc
tgcagcctgtgcatcctgaagatggaccatcactgtccctggctgaacaactgcgtcggc
cacctgaaccatcgctacttcttctccttctgcctctacatgaccctgggttgcgtctac
tgcagcgtcagcagcaggaacctgtttctggacgcctacagcgccatagagacttccttt
cagactccgcctccagatctgagccccagagagagcgttggccataagtgcatcatcttc
ctctgggtcctgaccagttcggtggcggtggcgctgggcggactgaccctgtggcacgcc
aagctgatcagcagaggagagaccagcgtggagcgccacatcaaccgcaaggaggccaga
cggctgcagggcaacggcaaggtgttcagaaacccgtaccatcatggccgcctgaacaac
tggaagttgttctttggagtggaaacaaggagccactggctgacccgggtcctgctgccc
tccagccatccgcccggcggggacggcctcttgtgggaccggccctccaccagcagcgat
ggccccatggccatctga

DBGET integrated database retrieval system