KEGG   Xiphophorus couchianus (Monterrey platyfish): 114152520
Entry
114152520         CDS       T05908                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00230  Purine metabolism
xco00240  Pyrimidine metabolism
xco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114152520
   00240 Pyrimidine metabolism
    114152520
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     114152520
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_17 Thymidylate_kin AAA_28
Other DBs
NCBI-GeneID: 114152520
NCBI-ProteinID: XP_027886230
Position
11
AA seq 261 aa
MATPPKRLRGAPTGSRRHRKISIEGNIAAGKSTFVRILQASSSDWEVIPEPIGKWCNVQS
DGDDVYQELSSSQKSGGNILQMLYDKPSRWAYTFQSYACLSRVRSQLQPPSAKLQQAENP
VQFYERSVYSDRYVFASNLFESGNLLDTEWSVYQDWHTWLLNQFEPDIALDAIIYLRAPP
QRCMQRLLHRGRQEEQGIPLEYLEQLHFKHEAWLYDRNLRLDFEYLSELPVLVLDVNEDF
HNDRIKQEDIVDKVREFLSTL
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcgactcctccgaagcggctccgcggagctccgaccggctcccgcagacacaggaag
atctccatcgagggaaacatcgctgcaggtaaatccaccttcgtccgcatcctccaggct
tcttcctcagactgggaggtgatcccagaaccgatagggaagtggtgcaacgttcagagc
gacggcgacgatgtctaccaggagctgagttcctcccagaagagtggagggaacatcctg
cagatgctgtacgacaagccgagccgctgggcctacaccttccagagctacgcctgcctc
agcagagtccggtctcagcttcagcctccatcagccaagctgcagcaggcggagaacccg
gttcagttctacgaacgctccgtctactcagacaggtacgtctttgcgtccaacctgttt
gagagcggcaacctgctggacacggagtggagcgtctaccaggactggcacacctggctg
ctgaaccagtttgaacccgatatcgctctggacgccatcatctacctgagagcccccccg
cagcgctgcatgcagcggctgctgcaccgcggccggcaggaggagcagggaatccctctg
gagtatctggagcagctgcacttcaaacacgaggcgtggctctacgacaggaacctccgg
ctggactttgagtacctcagtgaacttcctgttctggttctggacgtgaacgaagacttt
cacaacgatcggatcaaacaggaagacatcgttgataaggtcagggagtttctcagcaca
ctatga

DBGET integrated database retrieval system