KEGG   Xiphophorus couchianus (Monterrey platyfish): 114152694
Entry
114152694         CDS       T05908                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00100  Steroid biosynthesis
xco01100  Metabolic pathways
Module
xco_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    114152694 (tm7sf2)
Enzymes [BR:xco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     114152694 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 114152694
NCBI-ProteinID: XP_027886448
Position
11
AA seq 424 aa
MGPKKTLKHRLSNDTEREFGGTLGAVCIPVFLPLTVLFLICVSQSPEASVLQWPPCIPST
DQLWDPLAPILLLGWIGLHALLYLLPLGKVSDGLALRDGSRLKYPINGFHGLCISAVLLS
VLLGLGAPLAYLFELLVPLAVSAIAVSFLSSVYLYVRSFWAPSHALALGGDTGNPLYDFF
IGRELNPRIGNFDLKYFCELRPGLIGWGVINLGMLMKEAELRGSPSLSMILVNCFQLLYV
ADALWNEEAVLTTMDIVHDGFGFMLVFGDLAWVPFTYGLQASFLIVHPQSLSLLTAAAIV
ALNGAGYYIFRKSNSQKNQFRRDPTHPSVSGLETIATATGKRLLVSGWWGFVRHPNYLGD
LLMALAWSLPCGFSHLLPYFYVVYFTVLLVHREARDERQCRAKYGLAWDAYCRRVPYRIF
PYIY
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgggacccaagaaaaccctgaaacacagactgtcaaacgacacagaaagagagtttgga
ggaactctgggtgccgtgtgcattcccgttttcctcccactgaccgttctcttcttgatc
tgtgtgagccaatcaccggaggccagcgtcctccagtggcccccctgcatcccctccacc
gaccagctgtgggacccgctggctcccattctgctgctgggatggatcggactgcatgcc
ctcctctacttgctgccgttaggaaaggtttctgatggattagcgctgagggacggaagc
cgcctcaagtatcccataaatggtttccacggcctgtgcatcagcgccgtgttgctgtcg
gtgttgctggggctcggcgctcctcttgcatatctgtttgagctgctggtgccgctggcg
gtgtctgccatcgccgtgtcgttcctgtcctccgtctacctctacgtccgctctttctgg
gctccctcccatgctctggccctggggggagacacagggaatcccctttatgacttcttc
attgggcgggagctgaaccctcggatcggaaactttgacctcaagtatttctgtgaactc
agaccaggtctgattggttggggggtcattaacctcgggatgctgatgaaggaggcggag
cttcgcggttctccttccctctccatgatcctcgtcaactgcttccagctgctttatgtg
gcagacgctttatggaacgaagaggccgttctgacaacaatggacattgtgcatgatggc
ttcgggttcatgctggtatttggcgacctggcctgggttcctttcacctacggcctgcag
gcttccttcctgattgttcacccacagagtctatctttgctcacggcggcggccatagtt
gccctcaacggtgctgggtattacattttcagaaaatccaactcgcagaagaaccagttc
aggcgagacccgactcaccccagtgtttcaggactggagaccatcgccacagcaacaggg
aaacggctgctggtgtcaggctggtggggcttcgttcgtcatcccaattacctcggcgac
ctccttatggcgctggcgtggtccctgccatgtggcttctctcatctcttgccatatttc
tacgtggtttacttcaccgtcctgctggttcaccgggaggcccgggacgagaggcagtgc
agggccaagtacggactcgcgtgggacgcctactgtcgccgagttccctacaggatcttc
ccgtacatttactga

DBGET integrated database retrieval system