KEGG   Xiphophorus couchianus (Monterrey platyfish): 114152741Help
Entry
114152741         CDS       T05908                                 

Gene name
camkk1
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 1 isoform X1
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Brite
KEGG Orthology (KO) [BR:xco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114152741 (camkk1)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     114152741 (camkk1)
Protein kinases [BR:xco01001]
 Serine/threonine kinases: Other
  CAMKK family
   114152741 (camkk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal RIO1
Motif
Other DBs
NCBI-GeneID: 114152741
NCBI-ProteinID: XP_027886513
Position
11
AA seq 512 aa AA seqDB search
MAMSSDPGCERLDPNSSKQTSSLTDIMAAMTTKDPEGSSANGVKNGKAQQEGIQGKRVQV
LRPHLSGRKLSLQERGTYLSTGSEGGYTHISPRGARRPTVESKRVSISDSQDCIQLNQYK
LKSEIGKGSYGVVKLAYNEDDNKHYAMKVLSKKRLMKQCGFPRRPPPRGPKAAQGEQPKV
LGPLERVYQEIAILKKLDHVNIVKLVEVLDDPSEDNLYMVFELMRKGPVMEVPTETPFSE
EQARQYFRDIILGIEYLHYQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDALLSS
TAGTPAFMAPETLSEKCKSFSGKALDVWAMGITLYCFVFGKCPFIDEYILALHNKIKTKP
VDFPETPNICEELRTLILRMLDKNPDTRMTIPELKMDQWVTQGGTDPLPLEEEHCSMVEV
TEEDIQNSVKFVPSLSAVILVKAMLRKRSFSNPFECPSRREERSMSAPGSLLMDSWPFRP
SLKLHPSRRKSSAGDGPREGELEDLHEDEPFS
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgagcagtgacccgggctgcgagaggctggaccccaactcctccaaacagacg
agcagtctcaccgacatcatggccgccatgacgacgaaagaccccgaaggctcgtctgcc
aacggcgtgaagaacggaaaggctcagcaggagggcattcaaggcaagagggtccaggtg
ctgcgacctcacctgtccggcaggaagctgtcccttcaggagaggggcacctatctgtcg
acggggtcagagggaggttacacacacatctcccctcgaggggctcgcaggcccacggtg
gagtcgaaacgggtgtccatatcagactctcaggattgtatccagctgaaccagtataaa
ctgaagagtgagattggaaagggctcctatggcgtggtcaagctcgcctacaacgaagat
gacaacaaacattatgccatgaaggtgttgtccaagaagaggttaatgaagcagtgtggt
tttccacgtcgccctcccccaagaggacccaaggcagcccaaggagagcagcctaaagtc
ttaggacccttggaaagagtttaccaagagattgccattcttaaaaaactagaccatgtc
aacattgtcaagctggtggaggtgcttgatgatccatcggaggacaacctctacatggtg
tttgagctgatgcgtaagggtccagtgatggaggtgccaacagaaactcctttctcagag
gagcaagcacggcaatacttcagagacatcatcctgggcattgagtacctgcactaccag
aagatcgtccaccgggacatcaagccgtccaacttgttactaggagacgacggccatgtg
aagatagctgacttcggagtgagcaaccagttcgagggcaacgatgctctgctgtcgagc
actgcagggactcctgctttcatggcgccagagactctgtcagagaagtgcaagagcttc
agtgggaaagcgctggatgtgtgggccatgggaatcaccctgtactgctttgtgtttggg
aagtgcccatttattgacgagtacatattggctttgcacaataagataaagaccaagcct
gtggattttcctgaaacaccaaacatctgcgaagagctgcggacgttaatcttgcggatg
ctggacaagaacccggacaccagaatgaccattcctgagctcaagatggaccagtgggtg
acccagggaggcactgaccctctgcctttggaggaggagcactgctccatggtggaggta
acggaggaggacatccagaactctgtgaagtttgtccccagcctctccgctgtgatcttg
gtgaaagcgatgttgaggaagcgctcgttcagcaacccctttgagtgcccaagcaggcga
gaggagagatccatgtctgcacctggcagtctgctcatggactcgtggcccttcaggccc
tctttaaaactgcacccttcacgcagaaagagcagcgcgggggacgggcccagagaagga
gagctggaggacctccacgaagacgagcctttctcttga

DBGET integrated database retrieval system