KEGG   Xiphophorus couchianus (Monterrey platyfish): 114154410Help
Entry
114154410         CDS       T05908                                 

Gene name
wnk3
Definition
(RefSeq) serine/threonine-protein kinase WNK3 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Brite
KEGG Orthology (KO) [BR:xco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114154410 (wnk3)
   01009 Protein phosphatases and associated proteins [BR:xco01009]
    114154410 (wnk3)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114154410 (wnk3)
Protein kinases [BR:xco01001]
 Serine/threonine kinases: Other
  Wnk family
   114154410 (wnk3)
Protein phosphatases and associated proteins [BR:xco01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     114154410 (wnk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 114154410
NCBI-ProteinID: XP_027889318
Position
1
AA seq 3247 aa AA seqDB search
MATDPGEPTGTEDSPEKADGKKEEDKQREVRRDQQRERTPNTFLGLPSSQAQMDTEKGGD
ERGGGNGEAAFQKLGETPVLIPMPSVPVDTSQKRQRREKRFFRKSVEICDADDEIGMPPD
TPHSAPHLELHSTDSVFDSAQQQGAASSCVALGHDPSQGHEPGKDVPPSAPTPSVRERDR
EQEEEAEMKAVATSPGGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQDRKLTKAE
QQRFKEEAEMLKGLQHPNIVRFYDSWESVLRGKKCIVLVTELMTSGTLKTYLKRFKVMKP
KVLRSWCRQILKGLHFLHTRTPPIVHRDLKCDNIFITGPTGSVKIGDLGLATLMRTSFAK
SVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKP
ASFDKVNDPEIKEIIEGCIRQNKSQRLSIRDLLNHAFFAEDTGVRVELAEEDNGAQDCLA
LRIWVEDPKKLKGKHKDNEAIEFTYDLENDIAEEVALEMVKSGFFHESDAKVVGKSIRDR
VNLIKKSRERRQQQLTHQGFDDRRDSTVTSYVFSYPSCPSSLVVGAAGQTGGGESGAGGV
VQESEELPEVDQHVMQQHILGATTLSLPEIESVGSASCESYASGQSLALSLQGETYSHSQ
ITPQPLLSVTGASAETQILCTDETGIVPNLPLVQSVSMSNVCIPKTEGESVGQTFLQPSP
VVPQISPSVPQQYLQSQTFPSDAFQPLTAHGSMAPSQSNIPPIPPQAPIGVFPTSMSVSD
PAGITGTAMLHTQLPASPMQQADIIPHSTPQQTQCFVIPQQCIITQQPDMVSQTSTHQQQ
PPQPTSVEHQQINATQLPPEKQHHSLPATAIQKHHREPEQESFVQQPVQNVQSTPQQQVK
TTQTSMEPQALSVPRPGEQPQVYKLQPAGETCEQTVRQTQLQQQLQQQQSLLQQQQQLLQ
QQHLLLLERHPLYVQKLDQQQQMTLLQQQEHQTQLQQQKVLQHKQFMDQQQASLYQRYEQ
QQLSLLHQGQPTQAQVQQQPQIPSQQQQIQQLYQQTGQQQEGITLTEAETQEQSGQQQQN
TTLQQQPQQTQQNCEQVQQQTIFQQIEQQQALIQHHLQKQLILKQSQLQQAAQLQQQELQ
QIQLEQNLEHLQQQALLQKQLEKQLQNLPSDKQSAEFLQQQAQMKLQTQEKQQQQQAAII
QHLHQADKQELVPTPQSSSELQIPPQSANMQQMCNPQLTTFQSAEQSAKQDTMEQRQQLA
LIQQQAFVAQPQHHTSTATHRTVGVPVTIEGLQDQTDVISQVQVPVTIQTTPIPVQTAPV
FLGQQGQSPFHPQNQIPAQFLVQTVPQASQTTTVVSVSAPTAVIQGQTQVLQAQQIPLQA
SYPGPVTPTQAQVTAQSFIQTQPQHTTILQLQPAHGKVPDINTQMMCQQNQTTAQLSAAV
SSLPGPVQHETYIQQGALMKSPIQPKLQQETQGQPPCQLLSHPGLMIPQFVSQPPHQDIP
SVQHNMTHALQNQVHQQPVMQHQQMILSPGSAESAVTTTESLAQSADPVSVHVAPLPVQT
GQGIVPGQAALYPVAAVHQALIGSSADSTIIQPTSKTFMPQPAEQPQHQNQNPVHQPPGN
STAPLQLPAQPIQTPNQQPSLPQQTLTTLDKSQLPSQCPSHVLIQPSAQSGPSNVSMPQS
PTKTLPLYSHLITGTPSSPEHHAKQLLPAHTHTQTCIQAQTHSQTQTLVQTQTHSHTQTD
HKTPDSEESLLLKAMSDAQQLPLSPSCPSTTLPSALPQQPVPAAELSTSSQLAQVSLPGQ
ASFVPTSPQPASAQRLLDSNAPKPSQGSLQDCDISLLGTAQDGPYLASAECHSSTGSVSV
NGEDIQHNLGNGKSEKSKSQKKASSQKPEKGSHQFQLSMLQVSGKGDNLVECQLETHSNK
MVTFKFDIEGDAPEDIADYMVEEDFVLDLAKEKFVEELRSIVKKAQEILQTHTQTGSTDQ
LQVSTPSTSVVESVPQSSPVGRWRFFINQTIRHRDSLSSQGAVTPPPTVETKIPQSPQKD
EEKYASQTFESFTQKASSPHNTFSSASSPASAVPVPGSASVADTMAFETISGHASALVIA
PSVDQIPSCLSTTANPTPANVPTLNASPTLMSPPTNTIVSSNLTPAVTSVCSILGQSIED
ASRLSAVEKSSTSFHSTPVAAVSQLPIEDQQTFSQMATTVPLQSQLQVQPASQQQAATQP
QLLTLQFEQQIQQLTPKQQLSECHENPDQSLLQQEQPLLQEPQLLQRHTAVQQLPETLVL
PQSIQRELLQPSAQSLQILQPLPLQQSQPPQQQPFQYAGQMIQDSLIQQLPQQVLTPQSL
IVSQQQEPQHQQVVLQQMMQQKQMLQPQLQQQQHQLFIGVAAQGQMLPTSISQQFLQQQA
QLNVTPLPQHQISQPSQMPAEPVQPQALLQHSEQQYDRTKTTDSSQKQLQFASQKQSSLQ
MSESEGSTGETSITEDTGSFSGPLHPSSDSSLPPLHLASAEPHLPSLSLTMTPSPGQPSS
VAESDSEGPPKIEFVDNRIKTLDEKLRNLLYQEYSSGGTLPGAASISTSAASMSAGGDEL
SEPQALQRLSFHPPATSSDTSPHTPSSTTSSTTPRSSSTSPDPERGRGEYEALSEVGNLV
LSEPVEQQPIPSVPSASASSTKPISFCAPSKDGTAGSQHLLVSGEPTVPAVHPHSDTSAV
GDSSWPFSQQPISLQHGQQQHNAGGGYFGLNLTCPSIRNPVSKKSWTRKFKNWACKLRHS
ASLFKKPSVPQEGYLCSEALDDDKKETPLSSPQLCKGRFQVNPVPHSSPPKDLPSGQSST
HRKVGRFSVMRTVTKKEDRQTDSSPVSPDLGRDRRKTQAKEWDKEDCKMTPLKGHPSRGF
GHSHSPLGSSDDDDESELEDEGLRRELQMLREKHIREVVSLQAQQNRELQELYRQLRSLK
DQRQSLPAYLCRTPPLPAALPVVSPRRSRMAKAKLRSRPHSHMDNNGVPYSGIQQSSSFL
GGEQGRLRSAVPDRKDHSPSRKSTFTDELHKLVDNWTKEAVGPAPIKPSLNQIKQIQQVQ
GGWSQSAEVGRPGWFPAAQLNPQAPLASSPYAGGGTLTTLASPVPPAPQSHMGQAPQMHQ
SLHLHQPPPLQQMTYPQSPMCQQMPQPRMQTSIQSQVQPTILLPQPTPQSQPLLPSQIQI
PVSTATSLLHGGGPTVPTDSTAAIGGVFCSCSSPSPTCSSSCSTAALPSSAKIHPTTPTS
TLPLGQK
NT seq 9744 nt NT seq  +upstreamnt  +downstreamnt
atggctacagacccaggagagcccacaggcactgaggactcacctgagaaagctgatgga
aagaaggaggaggacaagcagcgggaggtcaggagagaccaacagagggagaggacacct
aacacctttttgggcctcccctcctcccaggctcaaatggacacagagaaaggaggagac
gaaagaggaggaggaaatggagaagctgcctttcagaagcttggagagactccggtccta
atccctatgccttcagttcctgtcgatactagtcaaaaacggcagagacgggaaaagcgt
ttcttcagaaagagtgtggagatctgtgatgcggatgatgagataggcatgcctcctgac
accccccacagtgctccccacctggagctgcactccacagattcagtctttgacagtgca
cagcagcaaggggctgcttcttcctgtgtagccttggggcatgacccctctcagggccat
gaacctgggaaagatgttcctccatctgcacccaccccgagtgtgagagagagggaccgt
gaacaggaggaggaagcagagatgaaggcagtagccacttcccctggtggaaggtttctt
aagtttgacattgaactgggcagaggagccttcaagactgtgtacaaaggccttgacacg
gagacctgggtggaagtggcttggtgtgaactacaggaccgtaagctgaccaaggcagag
caacaacgcttcaaggaggaggcagagatgttgaaaggtcttcaacaccccaacatagtc
cgcttttatgattcctgggaatctgtgctgcgtggaaagaagtgtattgtactggtcact
gagctaatgacatcaggaacacttaaaacctaccttaagcgcttcaaagtgatgaaaccc
aaagtcctgagaagttggtgcagacaaattctgaagggccttcacttcctccacaccagg
actccaccaattgtgcatcgggacctcaagtgtgacaacattttcataacaggccccaca
gggtcagttaagataggtgacctaggactggccactcttatgaggacctcctttgcaaaa
agtgtcataggaaccccagaattcatggctccagagatgtatgaggagcactatgatgaa
tcggtggatgtttatgcctttgggatgtgtatgctggagatggctacttcagaatacccc
tattctgaatgccaaaatgctgctcagatctatcgcaaagtcacaagtggtataaaacca
gccagctttgataaagtcaatgacccagaaatcaaggaaatcattgaaggctgcattcgt
cagaacaaaagccagagactctctatcagagacctcctgaatcatgcattctttgcagag
gatacaggagtaagagtggaactggcagaagaggacaacggagcccaggattgcctcgct
ctccgaatttgggtggaagacccaaagaagttgaaggggaaacacaaggacaatgaggcc
attgagttcacctatgacctggagaatgacattgctgaggaagtagctttggaaatggtg
aagtcaggcttctttcatgagagcgatgcaaaggtggtgggaaaatccatccgggatcga
gtgaatctgatcaaaaagtcaagagagcgtcgacagcagcagcttactcatcaaggcttt
gatgacagaagggattctactgtcacctcttatgttttttcttacccttcatgcccatcc
tcactagtggttggggcagctggacaaacaggaggtggtgaaagtggagctggaggagtg
gttcaggagtctgaggagctgcctgaagttgaccagcatgtcatgcagcaacatatcctt
ggtgcgacaacccttagcttgccagaaattgaaagtgttgggtctgccagctgtgagtca
tatgcaagtggacagagcctggcactctctctacaaggggaaacttattcccactcccag
ataactcctcaaccattgctatctgtcactggtgcatcggctgaaactcaaatactctgc
actgacgagactggaattgttccaaatctgcctcttgttcagagcgttagtatgtctaac
gtttgcattcccaagactgaaggagaatctgttggccagacctttcttcaacccagtcct
gttgttccacagatatccccgagtgtaccgcaacaatatcttcagtcacaaacatttcca
tcagatgcattccaaccactcactgctcatggatccatggctccctcacagtcaaacata
cctcccattcctccccaagctcccattggtgttttccccacatctatgtctgtcagtgac
cctgctggaattacagggaccgctatgctccacactcagctacctgcttctcccatgcag
caggctgacattattccccattccactccccagcaaacacagtgttttgttattccacaa
cagtgcattattacacaacagccagacatggtttcccagacctccacccatcagcagcaa
ccaccacaacccacatcagttgaacatcaacagattaatgcaactcagctgcctccagaa
aagcagcatcatagccttccagctacagctatccaaaagcatcaccgcgagccggagcag
gagagttttgtacagcaacctgttcaaaatgtccagtcaactcctcaacagcaagtgaag
accacacaaacaagcatggagcctcaagctttgtcagtgcctcggccaggggaacaacct
caggtttataaactgcaaccagcaggagaaacatgcgagcagacagtcagacaaacacaa
ctacagcaacagcttcagcaacagcaatctcttttacaacagcagcaacagctacttcaa
cagcaacacctgttgctccttgaacgacacccattgtatgtccaaaagcttgatcagcag
caacaaatgactctgcttcaacaacaggagcaccagacacagctacaacaacagaaagtg
ctgcaacacaaacaattcatggatcagcagcaagcttctctatatcagaggtatgaacag
caacagctaagtcttctgcatcaaggacaacctacacaagcacaagtgcaacaacaacca
cagataccttcacaacaacagcagatacaacagttatatcagcaaacagggcagcagcag
gaaggaataactctaacagaagcagaaacacaagaacaaagtggacaacagcagcaaaac
actacactgcagcaacaacctcagcaaacacagcagaattgtgaacaagtacaacagcaa
accatattccaacagatagaacagcaacaagcattaatccagcaccacttgcaaaagcag
ttaattttaaagcagtcccagttacaacaggcagctcagctgcaacagcaagaactgcaa
caaatacaacttgaacaaaacttggagcatcttcagcagcaagctctgttgcaaaagcag
cttgaaaaacaacttcaaaatctcccctcagacaaacaaagtgctgaatttttacagcag
caggctcaaatgaagcttcaaactcaagagaaacagcagcagcaacaagctgccatcatt
cagcatttgcatcaagctgacaaacaagaacttgtgcctacacctcaaagcagcagtgag
ctgcagattccgccacaatctgctaacatgcaacagatgtgtaacccccaacttaccact
tttcagtctgcagagcagtcagctaagcaagacactatggagcaacggcagcagctagca
cttattcagcagcaagcttttgttgctcagccacagcaccacacctccacggcaacccat
cgaacagttggtgttcctgtgaccattgaaggactacaagaccaaactgacgtaatctct
caagtacaggtcccagtgaccatacagactacccccattcctgtccagactgctcctgtt
ttcttaggacagcaaggacaaagtccatttcacccccagaaccagattccagcccagttt
ttagtccagactgtgccccaagcctctcaaactacaactgtggtcagtgtatctgcccca
acagccgtgatccaaggacaaacgcaagtcttgcaggcacagcaaattcctttacaggct
agttatcctggacctgtaactcctactcaggctcaggtaactgctcagtcatttatccag
actcagcctcaacatacaactattctacagctccagcctgcacatggcaaagtcccagac
atcaatactcagatgatgtgccaacaaaaccaaaccactgcccaactttcagctgcagtt
tcttctcttccaggtccagtacagcatgagacttacattcagcaaggtgctctaatgaag
agccccatccagcccaaactccaacaagaaactcaaggccaaccgccttgtcagctgctt
tctcaccctggcctaatgatcccacagtttgtctcacaacctccccaccaagacatacca
tctgtgcagcacaacatgactcatgctttgcaaaatcaggtgcatcagcaaccagtaatg
cagcatcagcagatgattctgtctccgggctcggctgagagtgctgtaacaaccactgag
agtctcgctcaatcggctgaccctgttagcgttcatgttgctcctcttccagtgcaaact
ggacaaggaatagttccagggcaagcagcactatatccagttgctgcagtgcaccaagcg
ttaattggaagctctgcagactctaccatcattcagcccacctctaagacatttatgcct
cagcctgctgagcagcctcagcaccaaaaccaaaatccagtccatcaacccccaggaaac
tctactgcaccacttcagttaccagcacagcccatccaaactcccaaccagcagccatct
cttccacaacaaaccttgacaacacttgacaaaagtcagcttccttctcagtgcccttca
catgtgttgatacagccctctgcacagtcaggacccagtaatgtttccatgcctcagtca
cccactaagactctccctctgtatagtcacttaataacagggaccccttcatctccagag
catcatgccaagcagcttctcccagcccacacacatacacaaacctgcattcaggcccag
acacactctcaaacacagacactggttcaaacacagactcattctcacactcagacagac
cacaagacaccagattctgaagaatctcttttgcttaaagctatgtctgatgcgcaacaa
ctgcccctgagcccttcatgtccctccacaacactaccatctgcactaccccaacaacct
gtccctgctgcagagctttctacatcttcgcaactagcccaagtatctttaccagggcag
gccagctttgtacctacctcccctcagcctgcctctgcacaacgattgcttgactctaat
gctcccaaaccctcccaaggctcgctgcaagactgtgacatttccctgctgggcaccgct
caggatgggccatacctggcaagcgcagaatgtcactcttcaacagggtctgtttcagta
aatggagaagacattcagcacaatttgggaaatggaaaatctgagaagtcaaaatctcag
aaaaaggcttcctctcagaaacctgagaaaggttcacatcagtttcaactgagcatgctc
caggtgtctgggaagggagacaatttggtagagtgtcagttagagactcatagtaacaaa
atggtgacattcaaatttgatattgaaggagatgcacctgaagatattgcagattacatg
gtagaggaagactttgtcctagatttagcgaaagagaaatttgtggaggagcttagatca
attgtgaaaaaagcccaagaaattcttcagacccatacacagactggatcaactgaccag
ttacaagtgagcactccctccacctctgtagtggagtctgtcccccagtcatcaccagtg
ggacgctggcgcttctttatcaaccagaccattcgtcacagagactctctgtctagccag
ggtgcagtcacaccaccaccaactgttgagacaaaaatcccacagtctcctcaaaaggat
gaagaaaaatatgcatcccagacttttgaatcctttactcaaaaggcttcttccccccac
aacaccttctcctctgcctcctctccagcctctgctgttcctgtccctggctcagcctct
gtagctgacactatggcctttgaaaccatctctggacacgcctctgctctggtcattgcc
ccttcagttgaccaaattcccagttgtctttcaactacagcaaacccaacccctgctaat
gtccccaccttgaacgcctctcctactctcatgtctcccccaaccaacaccatagtttcc
agtaaccttacccctgcagtcaccagtgtttgctccattctaggtcagagtatagaagat
gcatcaaggctatcagcagttgaaaagtcttcaacctcttttcattccactcctgtggct
gcagtaagtcaacttcccattgaggatcagcagacattttcccaaatggccaccacagtg
ccactgcaatcacagctacaagtgcagcctgcatcgcagcaacaagcagcaacacaacca
cagctgttaacactgcagtttgaacaacagatacagcagttaacaccaaaacaacagcta
tcggaatgccatgaaaacccagatcaaagtttgctgcagcaagagcagccactgctgcag
gaaccacaactgctgcaaaggcatacagctgttcaacaacttcctgagacattggtgtta
ccgcagtcaattcaaagggagttgcttcaaccatctgcacagtcactacagattctgcaa
ccattgcccctacagcaatcccagccaccacaacagcaaccgtttcaatatgctggacaa
atgattcaggactctctgattcaacagctaccacagcaagttctgacacctcagtctctt
atagtctcccagcagcaggagccacagcatcaacaggtagtcttgcaacagatgatgcag
caaaagcaaatgttgcagcctcagctgcagcaacaacagcaccaactctttataggtgta
gcagctcaaggtcaaatgttgccgacatccataagtcaacagtttctccaacagcaggca
cagctaaatgttacccctttaccacaacatcagatttcacaaccgagtcaaatgcctgca
gagcctgtgcagccacaagcactgcttcaacactctgagcagcaatacgataggactaaa
accacagattcatctcagaagcagctgcagtttgcaagtcagaagcagtcctctttacag
atgtctgaatcagagggctctacaggagagacgagcatcacggaggacacaggcagcttt
tctggcccgcttcacccttcatctgattcctctctgcctccactccatctcgcctcggct
gaaccccacctacccagcctttccctaacaatgacaccatcccctggtcaaccgtcctcc
gtggctgagtcagacagtgaaggtcccccaaaaattgaatttgttgataaccgtattaag
actttggatgaaaagctgaggaacttattgtatcaggagtacagcagcgggggaacgctg
cctggagctgcctctatttctacatcagctgcctctatgtcagcgggaggcgatgaattg
tctgagccccaggcactccaacgtttgtcttttcacccaccagccacttcctcagacacc
tccccccataccccatcctcaactacctcctccaccactccccgttcctcttctacctct
cctgatccagagagaggtagaggggaatatgaagctttatcagaagttggaaaccttgtt
ctgtctgaacctgtagagcagcaacccatcccctctgtcccctctgcttctgcctcatcc
accaagcccatttctttctgtgctcccagtaaggatggtactgctggatcccagcactta
cttgtatcaggagaaccaactgtacctgctgtacacccacactctgacaccagtgccgtc
ggagattcatcatggcctttcagtcagcaaccgatctccctccagcatggacagcagcag
cacaatgcaggaggtggatattttggcctaaacctgacatgtcctagtatcagaaatccg
gttagcaagaaatcctggactcgaaaattcaaaaactgggcatgcaaactgcgccactcc
gccagcttgttcaagaagcccagtgtcccacaagagggatatttgtgcagtgaggcactt
gacgatgacaagaaggagacaccattaagctcacctcagttgtgcaaaggtcgatttcag
gtgaatccagttccccacagctcccctccaaaggatctgccttcaggtcagagtagcact
cataggaaagtgggacgtttctctgtaatgcggaccgtgacaaagaaagaagacagacaa
actgacagctcaccagtgtctcctgatttgggacgcgataggaggaaaactcaggcaaaa
gaatgggacaaagaagactgcaagatgaccccattgaagggccatccttctcgtggtttt
gggcacagccactctccacttggcagcagtgatgatgatgatgagagtgagctagaagat
gaagggcttagaagagaacttcagatgctaagagaaaagcacatcagagaggttgtttcc
cttcaagcccagcagaacagagaacttcaagagctctacagacagcttcgttctctcaaa
gaccaaagacaaagtttacctgcctatctgtgccgaactcctcctcttcctgctgctctg
cctgtcgtttctccacgcaggtcccggatggccaaagctaagcttcgctcccgaccccac
tctcacatggacaacaatggagttccatactctgggattcagcagtcaagtagttttttg
ggtggcgaacagggtagactccgctctgcagtgcctgatagaaaagatcacagcccatca
aggaaaagcacattcactgatgaactgcacaaacttgttgacaattggacaaaggaggca
gtaggtcctgctccaatcaagccatctctgaatcaaatcaaacagattcagcaggtacag
ggaggctggagccagtctgcagaggtgggccgaccaggttggtttccagcagcccaactg
aacccccaggcacctttagcctcctctccttacgcaggtggaggaaccctgaccaccctg
gcctctccggttcctccagccccacaatcacacatgggtcaagcaccgcagatgcatcag
agtttacacctccatcagcctcccccccttcagcagatgacctatccgcagtctcctatg
tgccagcaaatgccacaacctcggatgcaaacctccatacagtcacaggtgcaacccacc
atcttgctgccccaaccaacacctcaaagccaaccgctgctgccttcccaaatccaaatc
ccagtgtccacggccacgtcgctgctacatggaggtggacccactgtacccactgacagc
accgcagctattgggggtgtattttgctcctgttcctccccctcgcctacctgttcttca
tcttgttcaactgctgctctaccttccagtgccaaaattcacccaacaaccccaacctct
actcttcctttgggacaaaaataa

DBGET integrated database retrieval system