KEGG   Xiphophorus couchianus (Monterrey platyfish): 114154705
Entry
114154705         CDS       T05908                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00230  Purine metabolism
xco00240  Pyrimidine metabolism
xco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114154705
   00240 Pyrimidine metabolism
    114154705
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     114154705
SSDB
Motif
Pfam: dNK AAA_18 AAA_33
Other DBs
NCBI-GeneID: 114154705
NCBI-ProteinID: XP_027889839
Position
12
AA seq 341 aa
MFLLINKRQGKCLLSIAMHFQMAALHRLLVLHRVSEIQKQGSGLMQLRRFAFTLWKPPNS
SFLRGRTTICSYMDKNIGDPSVSCSKNYSSSSKDGASRVKRVSIEGNVAVGKSTFAKLLQ
SVSTDWEVVQEPVGKWQNIEIKTSKEIDASPQGTVNNLLEMMYQDPQRWSYTFQTYSCVS
RMRIQLQAPPAHLLNAKESPVQVYERSVYSDRYIFALNMFELGCINTTEWATYQDWHSLM
VEQFGHRVELEGIIYLRASPKMCMERLKSRGRPEEEGVKLDYLETLHRQHEKWLVEKSTE
IHFEKLKKIPVLQLDASVAFNSDPKVQNLFVAKVKDFFKTL
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgtttctgctgattaataagagacagggaaagtgtttgctatccattgctatgcatttc
cagatggctgccctgcaccgactacttgtgttacaccgggtttctgaaatccagaaacag
ggttcaggtctgatgcagctcaggaggtttgcattcacactgtggaaaccaccaaacagc
tcatttctgagaggaaggacaactatctgcagctatatggataaaaatataggggatcca
agtgtttcatgctctaaaaactactcgagttcatctaaggatggtgcatcgcgagtgaag
agagtttctatcgagggaaacgtcgctgttggaaagtcaacctttgcaaaactcctgcag
tcggtttctacggactgggaggtggtgcaagagcctgtcggtaaatggcagaacattgag
atcaagacctcaaaggaaatagatgcttcaccccaaggaacagtcaacaacttgctggag
atgatgtaccaggaccctcagcgttggtcctacacatttcaaacatattcttgtgtgagc
cgaatgaggatacaacttcaggcccctcctgctcatctcctcaacgcaaaggaaagccct
gtccaggtgtatgagcgctcggtctacagtgacagatacatctttgctctgaatatgttt
gaactgggctgcatcaacaccactgaatgggcgacgtaccaggactggcactccctgatg
gtggagcagtttggacaccgggtggagctggagggcatcatctacctcagagcctcaccc
aagatgtgcatggagcgtctcaagtcacggggaagacctgaggaggagggagtgaagctg
gactacttggagacgctgcataggcagcatgagaagtggctggtagagaagagtactgag
atacactttgagaagttgaaaaagatccctgtgttgcagcttgatgccagtgtggcattt
aatagtgatcccaaagtgcagaatctgtttgttgcaaaggtgaaggacttctttaaaact
ttgtga

DBGET integrated database retrieval system