KEGG   Xiphophorus couchianus (Monterrey platyfish): 114154922
Entry
114154922         CDS       T05908                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Brite
KEGG Orthology (KO) [BR:xco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xco01002]
    114154922
Enzymes [BR:xco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     114154922
Peptidases and inhibitors [BR:xco01002]
 Metallo peptidases
  Family M1
   114154922
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 114154922
NCBI-ProteinID: XP_027890218
Position
12
AA seq 949 aa
MVKGFPVVLATMFPLLLVLFVSIHPSSGAQIPNQDQAKELPVATNGEPFPWDRMRLPVTI
SPLHYDLTIHPNLTSLDFTGVVRISLDVKEDTSIVILHAKQMHISNVVLLAPEGVRPLRV
LEYPRFHQLALLSESVLTKGRKYEVQLEFAANLSDSFHGFYKGSYRTSSGEVRAIASTQF
EATFARGAFPCFDEPAFKANFTIRIIREPRHIAISNMPKVKTVELPGGLLEDHFDTTVKM
STYLVAYIVSDFLSVSKTTKHGVKISVYAVPEKIDQTAFALDAAVKLLDFYDDYFDIPYP
LPKQDLAAIPDFQSGAMENWGLTTYRETGLLFDPDRSSASDKLGITKVIAHELAHQWFGN
LVTMEWWNDLWLNEGFAKFMEFISLDITYPELHVDDFFLGKCFEAMEVDSLSSSHPVSTP
VENPTQIQEMFDDVSYDKGACILNMLRDFLSPEVFEIGIIRYLKRYSYQNTVNSHLWESL
TDICSSDALDEGRLKHTEFCSKRKLQPGSSKWYSDDELDVKTIMDTWTLQEGFPLVTVEV
KGREVRLSQERFLRTDDPSLTEGFLWQIPLTYMTSASNTVHRFLLKTKTDVLYLPEEVDW
VKFNVNMSGYYMVHYAGEGWNSIIKLLQYNHTALSGNDRASLIQNVFQLVSVGKVRLDTA
LDLSLYLSKETQIMAVTQGFGELVPLYKLMEKRDMTVLENQMKGYIVDLFRDLIDRQEWS
DSGSVSERVLRSYLLLFACVRNHPPCVAKATKLFNQWKDSDGTMSLPVDITMAVFVIGAR
APEGWDFLFEKYRTSLQMSVKSRIKSAMTVTYLKDKLKWMMEQSLIGEVMKTQDLPDVVV
SVGRNPHGYKLAWDFLRANWHTMIKKFDLGSNSVSYMVLGVTNQYSTREMLQEIWSFFDS
LTEETGSKMRCIQQTYETIEDNIRWTDANFPLLEAWLNKHQHRPPHEDL
NT seq 2850 nt   +upstreamnt  +downstreamnt
atggtgaaaggatttcctgttgtccttgccaccatgtttcccctcctgctggtgctcttt
gtttctattcatccctcatctggagctcaaatcccaaatcaagatcaagccaaagagctt
cctgtagccaccaacggtgaacccttcccttgggaccgcatgaggcttcccgtaaccatc
agccccttgcactatgacttaaccatacacccaaacctcacctccctggacttcaccggg
gtggttcgcatcagtctggatgtgaaagaagacaccagcattgttatcctccatgccaag
caaatgcacatatccaatgtggttctcttggcacctgagggtgtccggcctctacgggtg
ctggagtaccctcgattccatcagcttgctttgctgtctgaatcagttctgaccaagggc
agaaagtatgaggtccagctggagtttgctgcaaacttatctgacagcttccatggtttc
tacaaaggcagctaccgtacgagcagcggggaggtccgggccatagcatctacgcagttt
gaggcgaccttcgctcgtggagccttcccctgttttgatgagcctgccttcaaagccaac
ttcaccatacggatcatccgtgagccacgccacattgccatttccaacatgcccaaggtt
aaaacagtggagttgccaggcggtttgcttgaggatcacttcgacacaaccgtaaagatg
agcacttacctggtggcttacatcgtctctgacttcctgtctgtgagcaaaacaactaag
catggagttaagatctctgtctatgctgtaccagagaagatcgatcagacggcctttgct
ttggatgctgcagtgaagttgttagacttctatgatgattactttgatatcccatatcca
cttcccaaacaggacctggctgctatcccggacttccagtctggcgcaatggagaactgg
ggtctgaccacctacagagagactggccttctctttgatcctgacaggtcctctgcctct
gacaaactgggcatcaccaaagtcattgcccatgagctcgctcatcagtggtttggaaac
ctggtgacaatggagtggtggaatgacttgtggctaaatgaaggttttgctaagttcatg
gagttcatttccctcgacattacctacccagagcttcatgtggatgacttcttcttgggc
aagtgttttgaggcaatggaggtagactctctgagctcgtctcatccagtttccacacca
gtggaaaaccccacacagatccaggagatgtttgatgatgtgtcttatgacaagggggca
tgtatcctgaacatgctgcgggacttcctgagccctgaagtttttgagatcggtatcatc
cgatacctgaagcgctacagctaccagaacactgtgaacagccacctgtgggagagcctg
actgatatctgcagctcagatgctctggatgaaggtcgactgaaacacacagaattctgc
tctaaacgcaaactccagcctggatcctctaagtggtactctgatgatgagcttgatgtc
aagactatcatggacacctggacactgcaggagggcttcccactggtcacagtagaggtc
aaaggtcgggaggtcagactcagtcaggagcgcttcctgaggacagatgatccctcgctc
actgaaggattcctgtggcagattccactaacgtacatgaccagtgcttccaacacagtt
catcgtttccttctcaagacaaagactgatgtgctctacctgccggaggaagtggactgg
gtgaagtttaatgtcaacatgagtggctattacatggtccactatgctggtgaaggttgg
aactccatcatcaaactgctgcagtacaaccacacggctctctctgggaacgaccgggcc
agcctcatccagaacgtcttccagctggtcagtgtcgggaaggtgaggctggatacggcc
ctggatctgtctctgtatctttccaaagagactcagatcatggctgtgacccagggcttc
ggagagcttgtgcctctttacaaactgatggagaagagagacatgacagttctggaaaat
cagatgaaaggttacattgtggatcttttccgggatctgattgatcgtcaagaatggagt
gactccggttcggtgtctgagcgagtgctgaggagttacctgctgctgttcgcttgcgtc
aggaatcatcctccatgtgtagccaaagccaccaagctctttaaccagtggaaggattca
gatggcaccatgagcctccctgttgacatcactatggctgtgtttgtgattggagcacga
gcaccagaggggtgggacttcctctttgagaaataccgcacttctctgcagatgtctgtc
aagagccgcataaagtctgcgatgaccgtcacctatctgaaggacaagctcaagtggatg
atggagcagagtttgataggagaggtgatgaagacccaggacctcccagatgtggtcgtc
tctgttggaaggaatcctcatggttacaaactggcctgggactttctccgcgccaactgg
cacacaatgatcaagaagtttgaccttggctctaattctgtatcatacatggtgcttggt
gtgaccaaccaatactctaccagggagatgctccaggagatatggagcttctttgactcg
ctgacagaggaaactgggtcaaaaatgaggtgcatccagcagacctacgagaccattgag
gataacatccgctggacagacgccaactttcctctgctagaggcctggctgaacaagcac
caacacagaccacctcatgaagacttatag

DBGET integrated database retrieval system