KEGG   Xiphophorus couchianus (Monterrey platyfish): 114155203Help
Entry
114155203         CDS       T05908                                 

Gene name
dhfr
Definition
(RefSeq) dihydrofolate reductase isoform X1
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00670  One carbon pool by folate
xco00790  Folate biosynthesis
xco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    114155203 (dhfr)
   00670 One carbon pool by folate
    114155203 (dhfr)
Enzymes [BR:xco01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     114155203 (dhfr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 114155203
NCBI-ProteinID: XP_027890793
Position
12
AA seq 208 aa AA seqDB search
MLCWRETLAVSSFEKSQTTFSMSRVLNGIVAVCPNLGIGKDGNLPWHPIRLSNEFAHFRK
MTATPSIAGRKNVVVMGRKTWFSIPEKNRPLKGRINIVLSREYKVPPAGAHYLASDFSSA
LTLVDTELAEQADQVWVIGGSSLYKELMESPGTRRLFVTQVLQQFDCDTFLPEIVPEKYQ
LLPEFPGVPKELQEENGIQYRFEVYENI
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgttggcgggaaacgctggctgtcagcagttttgagaagagtcagactacattc
tccatgtcgcgggtcctgaacggaattgtggcggtgtgccccaacctgggcattgggaaa
gatgggaatctgccctggcatcctattcgactcagcaacgaattcgctcatttccgaaag
atgacagccacaccgtcaatagcaggcaggaagaatgtggtggtcatgggcaggaagacc
tggttctcaatcccagagaagaacaggccactgaaaggcaggatcaacatcgtcctcagc
agggagtacaaggtgccacctgcaggcgcacactacctggcgtcagacttcagctcagct
ctaacactagttgacacagaactggcagaacaagctgaccaggtctgggttataggagga
agctctctatacaaggagttgatggaaagcccgggaaccaggaggctgtttgtcacacaa
gtcctgcagcagtttgactgtgacactttccttcctgaaatcgtcccagaaaaatatcaa
ctgctgccagagttcccaggagtcccgaaagagcttcaggaggagaatggaattcaatac
agatttgaagtgtatgaaaatatttaa

DBGET integrated database retrieval system