KEGG   Xiphophorus couchianus (Monterrey platyfish): 114155274Help
Entry
114155274         CDS       T05908                                 

Gene name
gpx8
Definition
(RefSeq) probable glutathione peroxidase 8
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00480  Glutathione metabolism
xco00590  Arachidonic acid metabolism
xco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    114155274 (gpx8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    114155274 (gpx8)
Enzymes [BR:xco01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     114155274 (gpx8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin SCO1-SenC
Motif
Other DBs
NCBI-GeneID: 114155274
NCBI-ProteinID: XP_027890887
Position
12
AA seq 210 aa AA seqDB search
MEALGGYPTKSSKARIKRLRVLVSMTVGVGCLFLLQTHLVKPRRQKDFYSFEVKDAKGRT
VSLEKYRGKASLVVNVASHCQHTEASYKSLQELHRELGTSHFNVLAFPCGQFGDTERGLS
RDIEAFAKSTYGVTFPFFSKIKILGTEAEPAFRFLTDSVQKIPKWNFWKFLVNQEGKVIR
FWKTDESMESVRKEVTALVREIIIRKRGEL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggaggctctcggaggttatcccaccaagtcctccaaagccagaataaaaaggcttagg
gtcctggtgagcatgacagtcggtgtggggtgtttgttcctcctgcagacgcacctggtg
aagcccagaagacagaaggacttttattcgtttgaggtgaaagacgcaaaggggaggacg
gtatccctggagaagtaccgaggaaaagcatcgctggttgtaaacgtggcgagtcactgc
cagcacacggaggcgagctacaagtctctgcaggagctgcaccgggagctgggtacgtct
cacttcaacgtcctggccttcccctgcggccagttcggggacacggagcgcggcttgagc
cgcgacatcgaggccttcgccaagtccacatacggcgtgacgttccccttcttcagcaag
atcaaaatcctgggcacggaggctgagcctgccttcaggttcctcacagattctgtgcag
aaaataccaaagtggaatttttggaagtttctcgtgaatcaggaaggaaaagtgatccgg
ttctggaaaacagacgaatccatggagagcgtccgaaaagaggtcacagcactggtgcga
gaaatcatcataaggaaacgtggggagctatga

DBGET integrated database retrieval system