KEGG   Xiphophorus couchianus (Monterrey platyfish): 114156978Help
Entry
114156978         CDS       T05908                                 

Definition
(RefSeq) titin-like isoform X1
  KO
K12567  titin [EC:2.7.11.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Brite
KEGG Orthology (KO) [BR:xco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114156978
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114156978
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:xco04812]
    114156978
   04147 Exosome [BR:xco04147]
    114156978
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114156978
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   114156978
Membrane trafficking [BR:xco04131]
 Others
  Actin-binding proteins
   Others
    114156978
Cytoskeleton proteins [BR:xco04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     114156978
Exosome [BR:xco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   114156978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 Pur_ac_phosph_N ig fn3_2 Ig_2 Tissue_fac fn3_4 SusE DUF11
Motif
Other DBs
NCBI-GeneID: 114156978
NCBI-ProteinID: XP_027893451
Position
2
AA seq 2138 aa AA seqDB search
MERSKNNMTNEAEEMPQTLNIKMTEDSNPEVSSSTSVTAQGQQSSSAESEQNRTTTASAK
NKENAIRPKLQLTFNTFTVKSGEDLKIEILVVGDPAPKIEWKKEGQAVKETSRLEILNKA
SLTLLHIRHGVREHSGQYSVTASNSAGKDTTTITVVVLEKPDPPIGPVRIDEVNSDYVIM
SWDPPSYTGGCQLENYVVEKRETTSTEWHTVSATTVRTTIKVTKLKTGNEYQFRISAENR
YGKSAAITSPVVTAKYPFSVPACPGSPLISTVTKYSMVVEWEPPLRDGGSPIIGYHIERK
EKNSILWTKLNKFVIPDSRFKASGLEEGIEYEFRVFAENIAGLSPCSNTSECCVARDPCD
SPGKPEAVVVTRDSITLQWAKPKYDGGSTITGYVVEKKELPDGRWMKVNFTNVTDNLFTV
SGLTGGQNYEFRVTAKNSAGVWSVPSESITILAQDVIEAPTAFIDPTFKSTIIIQAGETF
VIEADYFGKPLPEVAWLKDGKEIEKGTPKIEVKNTITHTTLTARDCTRVDGGRYVLSLSN
SGGTTTISVNVKVLDRPGSPDGPLKVKVISAEKCNLNWNPPLNDGGASITHYIIEKRETS
RVTWTEVEPHIEDISYKVTKLVCGKEYVFRIAAVNKYGAGDFLESEPFVAQNPFKPPSAP
STPVASAVTGDSVVLTWERPESDGGSEIDGYILEKRDKDGVRWTKCNKRRLNDMRFRCTG
LAEGHYYQFRVLAENAAGVGAPSESSEYIKVCEATYPPGPPSNPKVTDYSSSTVSLIWSK
PIYDGGDTINGYTVELKEATVDEWIACTPSTGIEDTKYTVKRLKGNTEYNFRICATNSTG
VGEHVDLPGSVVTTEKVEAPEIELDNALRKIVNVRACSTLRLFVTLRGRPEPEVRWTKED
GTLDERAQIQVTNSYTVLMIENVTRNDSGKYVLTAENCSGSKSAFINVRVLDSPSAPTNL
EVKDVKRDSVSISWEPPLIDGGTKISHYIVEKREEARKAFTSVCSNCVRNSYKIDNLHQG
SFYYFRVIAVNEFGPGQPAETAEAVKVSEAPPPPGKITLSDVTCNSARLSWEKPDHDGGS
KIASYTVEMQTRGDNIWTKYSESKALEVTIDGMTAGKEYFFRVSAVNDKGTSEPKSLLTP
VVVKDNSAKPVINLLNNTFNVKVGNDLKIDVPFKGMPLPTVVWNKEGNMLKETSRVTVQT
SESASQVFIKDATRFDAGVYEVILSNAAGTTSAEIFVNIFERPGPPSDLSVEEVSADFVS
LTWQPPLYTGGSEISNYIVEKRDIGSSVWQNVSATVARSSIKVSRLTQGTEYQFRVAAEN
RYGKSQYLETETVIAQYPFRPPGPPTNIHVVQASKSVMIIAWDKPDSDGGSPIIGYHVES
KDQSSILWTKVNRSPVIENQYKVTNVEEGLIYEFRICAENLAGVGPCGKPSESVAARDQC
DAPSNLKVTNVTNTSVSLSWDKPHYDGGAKITSYIVERIELPDSCWLKCNFTNLMDTFFE
VSELSEGEQYEFRVTAKNAAECFSAPSETTGPITVQHDIEPPIIILDEKFRQVVVVKAGD
VLKIDAEIYGRPNPTVFWLKNGRNISTKGRVEILATKSHTSLLVRESVRKDSGQYTLTVQ
NTGGATSRAVTCKVLDIPGPPAGPLEVSGQSAEKCTLSWGPPHENGGAEVLHYVVEKCET
SRISWTLVYGDMMATTCKITKLLKGNEYIFRVRAVNKYGEGEILESEPIKAMDSFTIPSA
PRDVEVTSATSESMTISWKRPACDGGSRISGYVIEKREKHGVRWVRVNKKTVYDLRVKAC
GLHEGCEYEFRVFAENAAGLSEPSAPSPLALAEDPKFLPSSPTKPTITDSSKSSITLTWN
KPLFDGGAPITGYKVELKKTAEDDWTVGVQNTDKTEFTVTGLTTGAEYVFIVRSINKIGL
SEPSPETEPELALEREEEPMFNINPEMRKTLLVKDGCSFTLTVPFTGKPVPSVSWEKADV
DLRVRGLIHTSSFITSITIEQATRDDSGKYKVKLQNVAGSATLIINVKVLDSPGPPINIT
VKDVTKNSATVTWDIPENEGGGPVKSYLVDIRDISRKGWTRLTDKCRRLSYKVSDLEEGG
IYFFRVTGENEYGIGVSAETKKGTKMTGTTDWETNQRA
NT seq 6417 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaagtaaaaataatatgacaaatgaagctgaagaaatgccccagactctaaat
ataaaaatgactgaggattctaatccagaggtttcatcatccacctcggtcactgcccaa
ggtcaacaatcttcttctgcagagagtgaacaaaacaggacaacaactgcctctgcaaaa
aacaaggaaaatgccatcaggccaaaactccagttaacatttaacacattcacggtcaaa
agtggtgaagatctaaaaatagagatccttgtggttggagaccctgcaccaaagattgaa
tggaaaaaagaaggtcaggcagtaaaggagacatcaaggctagagattttaaataaagcc
tctttaactctccttcacatcagacatggtgtcagagagcattctggtcagtactctgtc
acagcaagcaactctgccgggaaagacacaacaaccatcacggtggttgttcttgaaaag
ccagacccacccatagggcccgtgaggattgatgaggttaattctgactatgttattatg
tcctgggatccaccttcatatacaggaggctgtcagttggagaactacgtagtggagaaa
cgggaaacaacaagcacagagtggcacactgtgtctgcaacaacagttagaaccaccatc
aaagttaccaagctgaagacaggaaatgaataccaattcaggatatctgcagaaaatagg
tatggaaaaagtgctgcaatcacgtctccagttgtgacagcaaaatatcctttcagtgta
cctgcttgtcctggctctcccttaatatccactgtgacaaagtatagcatggtggttgag
tgggagccaccactcagagatggaggcagccccatcattggctatcacattgaacgtaaa
gagaagaacagtattttgtggaccaagctgaacaaatttgttatacctgacagtcgcttc
aaggcaagtgggctggaagaaggcattgaatatgagttcagagtctttgctgaaaacatt
gcaggactgagcccatgcagtaatacatcagagtgttgtgtggcaagagatccctgcgat
tcacctgggaaacctgaagcagttgtggtgaccagggacagcatcacacttcagtgggca
aaacctaaatatgacggaggaagcaccatcacaggatatgttgtagaaaaaaaggaactc
ccagatggcagatggatgaaggtgaactttaccaatgttactgacaatcttttcacagtt
tcaggactgacaggagggcaaaactatgagtttagggtaactgctaagaacagtgcgggc
gtttggagtgtaccctcagaaagcataaccattcttgctcaggatgttatcgaagcaccc
actgcatttattgatcctacatttaagagtactattatcatccaagctggagaaactttt
gtcattgaagctgattactttgggaagcctctcccagaagttgcatggctgaaagatgga
aaagaaattgagaaaggtacacctaaaatagaagtcaaaaacacaatcactcatacaact
ctcactgctagagactgcacacgtgtggatggaggacgctatgtgttgagtcttagtaac
agtggtggaactacaaccatttcggtaaatgtgaaggtcttagatagacctggttctcct
gatgggccactaaaggtgaaggttataagtgcagagaaatgcaaccttaactggaacccc
cctttaaatgatggaggtgccagcatcacccattacatcattgaaaaaagggaaaccagt
cgtgttacatggacagaggttgaacctcacattgaagatataagttacaaagtgacaaaa
ctggtatgtggcaaagaatacgtcttcagaattgctgctgtaaataaatatggggctggg
gattttttagaatctgagccttttgttgcacaaaatcctttcaagccacccagtgctccc
tccactcctgtagccagtgctgtgactggagactcagtcgtgctaacatgggaaaggcct
gagagcgatggaggctctgagattgatggctacatcctggagaagcgtgacaaagatggt
gtgcgatggaccaaatgcaacaagagaagattaaatgacatgcgctttagatgtactggg
cttgcagagggacattactatcaatttagagttctggcagaaaatgctgctggtgtgggc
gcacccagtgagtctagtgagtacataaaggtatgtgaagctacatacccacctggccca
ccttcaaacccaaaagtaacagattattccagcagtacagtgtctctcatctggtcaaaa
ccaatttatgatggtggagatacaatcaatggatatactgtggaattgaaggaagccaca
gtagatgaatggattgcatgcacaccgagcacaggaatagaggacacaaaatacactgta
aaaagattaaaaggaaatacagagtacaattttcgtatatgtgcaacaaattcaactggt
gttggagaacatgtggatctacctggttctgtagtaacaactgaaaaagtagaagcacca
gagattgaactggacaatgctctgagaaaaattgtaaatgttcgagcctgctccacctta
cgtctctttgtcaccttaagaggacggccagagcctgaagttaggtggacaaaagaagat
ggcactttagatgaacgcgctcaaattcaagtaacaaactcctacactgtgttaatgata
gaaaatgtcacaagaaatgacagtgggaagtatgtgttgactgctgaaaattgcagcggt
tccaaatcagcattcatcaatgtgagagtactggattctcccagtgctccaacaaattta
gaagtaaaggatgtaaagagagactctgtctccatctcctgggagccacctcttattgat
ggaggaacaaagatttcacactacatagttgaaaagagagaagaggcaaggaaggcattt
accagtgtttgtagcaactgtgtaagaaattcctacaagattgacaatctacatcaggga
agcttttattattttcgggtgattgcagttaatgagtttggccctggacaaccagcagag
actgctgaagctgttaaagtgtctgaagctcctccgcctcctggcaaaatcacactgagt
gatgttacttgcaatagtgccagactttcatgggagaagcctgatcatgatggaggaagc
aaaatcgccagctacactgtagaaatgcaaaccagaggagacaacatatggacaaaatat
tcagagagtaaagcactagaggtgaccattgatgggatgacagcaggaaaagagtatttc
tttagagtgagtgctgtgaatgataaaggaacgagtgaaccaaaatccctgttgacacct
gttgtagtaaaagataatagtgctaaacctgttatcaatctgttaaacaacacatttaat
gtaaaagtagggaatgatctaaagattgatgtacctttcaaaggtatgccactgccaaca
gtagtctggaataaagagggaaatatgttgaaggagacaagcagagtaactgtacaaacc
tctgaatctgcatctcaagtatttatcaaggatgcaacaagatttgatgccggtgtgtat
gaggtaattctgagcaatgctgctggaacaacatcagctgaaatttttgtgaacattttt
gaaaggcctggaccgccaagtgatctcagtgtggaagaagttagtgccgactttgtatct
ctgacatggcaaccccctctttacactggtgggagtgaaataagtaattacattgttgag
aaaagagacataggcagttcagtatggcagaatgtgtcagctacagttgcaagatcatca
atcaaagtttcccgtctgactcaagggactgaatatcaatttcgagttgctgcagagaat
cgctatggaaaaagccaatatcttgaaacagaaacagtcattgcccagtatcccttcaga
ccacctggtccaccaactaacattcatgttgtccaggcctcaaagtctgtaatgatcatt
gcttgggacaaaccagacagtgatggtggcagtcctatcattggttatcatgttgaaagc
aaagatcaaagcagtatcctatggacaaaagtaaacaggagcccagtgattgagaaccaa
tacaaggtgacaaatgttgaagaaggtctgatatatgagtttcgtatctgtgctgaaaat
ttagccggtgttggaccctgcggtaagccatctgaatctgtcgcagcaagagaccagtgt
gatgcaccttcaaatctcaaagttaccaatgtaaccaacacttcagtttcactctcctgg
gataaaccacactatgatggaggagccaaaataacaagctacattgtagagcgcatagaa
ctgccagatagctgctggttgaagtgcaactttacaaatttaatggacactttttttgaa
gtatctgagctctccgagggtgaacaatatgaatttcgtgttactgcaaagaatgcggca
gagtgctttagtgcaccctctgaaaccactggacccattacggtgcaacatgatatagag
ccgcccattattatcttggatgaaaaatttaggcaggtggtggtagtcaaagcaggagat
gtacttaaaatagatgctgaaatttatggtcgccctaaccccacagtgttttggctgaaa
aatggaagaaacataagcaccaagggaagggttgagatattagcaacaaagtcccataca
tctctccttgtcagagagagtgttaggaaagattctggacagtatactctgaccgtacag
aacacagggggtgccacatccagggctgttacctgcaaagtgctggacataccaggccct
cctgctggacctctggaagtgtctggacaatcagcagaaaagtgtaccttgtcctgggga
cctcctcatgagaatggaggtgcagaggtcttgcactacgttgttgagaaatgtgaaacc
agtcgtatttcctggacccttgtgtatggtgacatgatggcaaccacttgcaagataacc
aagctcctcaaaggaaatgaatacatttttagagtgagagcagtaaacaaatatggagag
ggagaaattttggaaagtgaaccaataaaagctatggattccttcactatcccatctgct
ccaagagatgttgaagtcactagtgctaccagtgaatctatgaccatctcctggaagagg
cctgcttgtgatggtggtagccgtatcagtggttatgttatagagaaaagggaaaagcat
ggtgtccgctgggttagagtcaacaaaaaaacagtctatgacttacgagtcaaagcttgt
ggcctgcatgagggatgtgagtatgaatttagagtatttgctgagaatgctgctggtcta
agtgaacccagtgcaccatcccctcttgccttggcagaagatccaaagtttttaccttcc
tctccaacaaaacccaccattactgattcctccaagtcctccatcactctaacatggaat
aagccactgtttgatggtggagcaccaattacagggtacaaagttgaattaaaaaaaact
gcagaggacgactggactgtaggtgttcagaacacagataaaacagagtttacagtgact
ggacttacaacgggggcagaatatgtgttcattgttagatctattaataagattggcttg
agtgagcccagtcctgaaacagaacccgaacttgccctggaaagggaggaagagcccatg
ttcaacattaaccctgaaatgagaaagactcttcttgttaaagatggatgtagctttact
ttgactgtacctttcacaggcaaacctgttcctagtgtgtcatgggaaaaagcagatgtt
gatctaagggtaaggggacttatccacaccagcagcttcattacctctatcacaatagag
caggcaacacgtgatgactctggcaaatacaaagtcaagcttcaaaatgttgctggatct
gctactttaatcataaatgtgaaggttttggattcaccaggtcctcctatcaacataaca
gtcaaagatgtgactaagaactctgccactgttacctgggatatccctgagaatgaagga
ggggggcctgtgaagagctacctggtagacatacgagacattagcagaaaaggttggaca
agactcacggacaaatgcagacgactgtcatataaagtgtctgacctggaagagggagga
atctacttctttagagtcactggtgaaaatgaatatgggattggtgtttcagctgagaca
aaaaaaggaacaaaaatgacagggacaacagattgggagaccaaccaaagagcgtaa

DBGET integrated database retrieval system