KEGG   Xiphophorus couchianus (Monterrey platyfish): 114157142Help
Entry
114157142         CDS       T05908                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114157142
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xco04030]
    114157142
G protein-coupled receptors [BR:xco04030]
 Rhodopsin family
  Lipid
   Leukotriene
    114157142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Serpentine_r_xa
Motif
Other DBs
NCBI-GeneID: 114157142
NCBI-ProteinID: XP_027893766
Position
14
AA seq 385 aa AA seqDB search
MNFSLGSSMNTTTAVPFSPSPNNVSARIGTAILILAFLLGFPGNMFVVWSVLCRVKKRSV
TCLLVLNLAVADGFVLLSAPLFIRFLVAGRGWEFGSAACKLVHYLSSVNMYVSIYLICLM
SMDRWLAVTRPFMSQRMRTKRSLLLLLFGVWVLAFLLSLPMPFYRSIIKMHIRNSSISIC
MPYHWGSMCHPVFQYLFETVMGCLVPFSLISTCYSSVICRLQSAKFQRRGQGSRLILLII
VTFAIFWLPYHVVNIIEVACLLKNDNLGKPCSPSARPNVTAFAYFSSAVNPILYVFAGSS
HIRQAGLSFMGRLFEATNSESRTTSTIARSGRSGSSPDESAVLYSLSTKIGKPFKGKGKE
RSSSLAGKEANEPALKTLATVEQLE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttctttggggtccagtatgaacaccactaccgccgtgcccttctcgccttct
cccaacaacgtctcggctcgcattggcaccgccatcctgatcctggcgttcctgctgggt
ttccctggcaacatgttcgtcgtctggtcggtgctctgccgggtgaagaagcgctcggtg
acgtgcttgttggtgctgaacctggccgtggccgacggcttcgtgctgctcagcgccccg
ctgttcattcggttcctggtggcaggacggggctgggagtttggctcggcggcgtgcaag
ctggtgcattacctgtcgagcgtgaacatgtacgtgtccatctacctgatctgtctcatg
agcatggaccgctggctggccgtcacgaggcccttcatgtctcagagaatgaggaccaag
cgctccctgctcctcctcctgtttggggtctgggtgttggctttcctcctgtcactacca
atgccgttctatcgcagtattataaagatgcatataagaaacagcagcataagcatttgc
atgccataccactgggggagcatgtgtcacccggtcttccagtacctgtttgagaccgtc
atgggctgcttggttcccttctcgctcatcagcacctgctactcctccgtcatatgcaga
ctgcaaagtgccaagttccagcgccgaggacaaggcagtcgtctcatcctgctgatcatc
gtcacctttgccattttctggcttccctatcacgtcgtcaacatcattgaggtggcttgt
ttgctgaagaacgataacctggggaagccctgctctcccagcgctcggcccaacgtcaca
gccttcgcctacttcagcagcgcggtgaaccccatcctctacgtgttcgccggcagctcc
cacatccgccaggccgggctcagcttcatgggccggctcttcgaggccaccaactcggag
agcaggaccacgtccaccatcgcccgcagcggccgcagcggctcttcgccggacgagagc
gccgtcctgtactcgctgtcgaccaaaatcgggaagcctttcaaaggaaagggcaaggag
agaagcagcagcctggcgggcaaggaagctaacgaaccagcgctcaaaactcttgccacg
gtcgaacagttagaatag

DBGET integrated database retrieval system