KEGG   Xiphophorus couchianus (Monterrey platyfish): 114157806
Entry
114157806         CDS       T05908                                 

Gene name
ankrd53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Brite
KEGG Orthology (KO) [BR:xco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xco03036]
    114157806 (ankrd53)
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    114157806 (ankrd53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank_3 Ank Trans_coact
Other DBs
NCBI-GeneID: 114157806
NCBI-ProteinID: XP_027894769
Position
14
AA seq 390 aa
MERSNTSRKRGRGRGKSRKSSRKASSGEPVLPDVDPDSTELLAEEKLSALHIACLYGELH
TIRLIIKARPLWVNLGDSKGRRPLHIVLSSQRFSNTYTIFKYLMEQGADINAATNSGETP
LHTAASRGLLSCTEMLVNAGADILARDKMGLTPLDMAHIWNHRKTARYLKHCLWYCEKQD
EMEETQLTQMLYRELIDLVKQKNLNEKSLIEAKVEEWAKKRGLSPLKTLTPRSKASKYHN
NCSSPEKNKRQPKPTKGESKHIQEKKDVSKAQQPPLPDSPWTVFGLHPEKPCTDPDLRKD
VMLLKNSINQRLHYMTKWDTAPHLAPDLPLDKIQRLLFPRAFSSRLNTSWDFEPRDIKKV
QHKGFPQGRSTSPWTEVVMHLVEVLELGHY
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggagcgctctaacacaagcaggaagcgaggccgcggacgaggtaagagcaggaagagt
tcccgtaaagcttcatctggtgagccggtactgccagatgttgatcctgacagcactgag
ctgctggcggaggagaaactctcagccctccatatagcttgcctgtatggtgaactgcat
actatccggctcataataaaggccaggccgttgtgggtcaacctcggtgattctaaaggt
cgccggcccctgcacatcgttctgtcctcacagcggttctccaacacgtacaccattttc
aaatacctgatggagcaaggagctgatatcaacgctgcaacaaattcaggggaaaccccg
ctgcacactgccgccagcaggggcctcctcagctgcacagaaatgcttgtgaacgcagga
gcggatattttggcaagggacaaaatggggctgacgcctctggacatggcgcacatctgg
aaccacaggaagacagcacggtacttgaagcactgcttgtggtattgtgagaagcaggac
gaaatggaggagacacagttgactcagatgttatacagagagctcatagatctggtcaag
cagaaaaatctgaatgaaaagtcccttattgaagcgaaggttgaagagtgggcaaagaag
agaggcttgtctccgttgaagacgctcacgcccagatccaaggcgtccaaataccacaat
aactgcagctcaccagagaagaacaagaggcaaccaaaacctaccaagggagagtccaaa
cacattcaagaaaagaaggacgtctccaaagcacagcagccccccttacccgacagtccc
tggactgtctttggcctccacccagagaaaccctgcacagacccagacctcaggaaagat
gtcatgttgttgaagaacagcatcaaccagaggcttcactacatgaccaagtgggacaca
gcgcctcacctcgctcccgacctgcctctggacaagattcagagattgttgtttcccaga
gcgttttcttctcggctcaacacgtcatgggactttgagccgcgggacatcaagaaagtc
cagcacaaaggtttccctcagggaaggagcacctctccctggacagaggtggtcatgcac
ctggttgaggtcctggagctgggacactactag

DBGET integrated database retrieval system