KEGG   Xiphophorus couchianus (Monterrey platyfish): 114159852Help
Entry
114159852         CDS       T05908                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit-like
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04260  Cardiac muscle contraction
xco04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114159852
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    114159852
   04261 Adrenergic signaling in cardiomyocytes
    114159852
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xco04040]
    114159852
Ion channels [BR:xco04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   114159852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 114159852
NCBI-ProteinID: XP_027897873
Position
16
AA seq 396 aa AA seqDB search
MSNRNQTAEQDQVALLSLSLSLSIFLFLSAFLPLSLSLPHPFYCSIDTLLHLLRQLTVLQ
RILFITGEFTSLFFHQDFLFLTVNCKILWLTLYKQRIVPGPSFFILFYFIYYNNNHLLET
MSAWSRKALTLLSSVFAISGLGLLGVAVSTDYWLYLEEGVIMPLNQTADIKTSLHSGLWR
VCFLAGEESGRCSTIEYMMPTSLQLTSESTGNVLKMIRSSTPFPLVSLFFMFIGFVLNNI
GHVRPHCTILAFVSGIFFILSGLALVVGLVLYISSINDEMLNRTKSSEVYFSYKYGWSFA
FAALSFLLTESAGVMSVYLFMNRYTAEEIYQARRPNFHRPRLSNCSDHSGQFLHPESWSR
GRSPSDISSEASLQMSASYPALLKCPDYDQVSSSPC
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacagaaatcagacagcagagcaggaccaagtagctctcctctctctctctctc
tctctctccatctttctctttctctctgcttttctccctctctctctgtctctccctcac
ccgttttactgtagcatcgacacactgcttcatcttctccgtcaactcactgttctccag
aggattttattcatcactggtgaatttacctcattattcttccatcaggactttttattt
ttaaccgtgaactgcaagattttgtggttaacactttacaaacagcgtattgttccagga
cccagtttttttattttattttattttatttattataacaacaaccatcttttggaaacc
atgagtgcgtggagcaggaaggctctgactttactcagcagtgtctttgcaatcagtggc
ctggggctgctgggagtggcggtgagcacagattactggctctacctggaggagggagtc
atcatgcctctgaaccagacggctgacatcaagacgtcactgcactcaggtctctggagg
gtctgctttctggctggtgaggaatccggccgctgctccaccatcgagtacatgatgcca
acgagtctccagctgacgtcagagtccacaggaaatgtactcaagatgatccgctcatcg
accccattccctctggtcagcctcttcttcatgttcatcggttttgtcctcaacaacatc
ggacacgtccgtcctcactgcaccatcctggcgtttgtttcaggaatcttctttatcctt
tctgggctggctctagtggtgggtctggtattgtacatctccagcataaatgatgagatg
ctgaacagaacaaagagcagtgaggtctacttctcctacaaatatggctggtcttttgcc
ttcgctgccctctccttcctgctcactgagagtgcgggagtcatgtctgtctacctgttc
atgaaccgctacacagcagaggagatctaccaggctcgccgccccaatttccaccggcct
cggctcagcaactgctctgaccactccggtcagttcctccacccagagtcctggtcgcgt
ggacgaagcccctctgacatttcaagtgaagcgtcactgcagatgagcgccagctacccc
gctctcctcaaatgtcccgactatgaccaggtgtcatcttcaccttgctga

DBGET integrated database retrieval system