KEGG   Xiphophorus couchianus (Monterrey platyfish): 114159907Help
Entry
114159907         CDS       T05908                                 

Definition
(RefSeq) heat-stable enterotoxin receptor-like
  KO
K12320  heat-stable enterotoxin receptor [EC:4.6.1.2]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00230  Purine metabolism
xco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114159907
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114159907
Enzymes [BR:xco01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     114159907
Protein kinases [BR:xco01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   114159907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase ANF_receptor
Motif
Other DBs
NCBI-GeneID: 114159907
NCBI-ProteinID: XP_027897967
Position
16
AA seq 1085 aa AA seqDB search
MRSSWDCLLYLGVLGVLGVLGVVASGHKMLDDCLTSDRKYKMNVVLLEDNTYEWSRPFVQ
RAVEHAIEKDRQKNVDNDLDLVLTANYNGFNTTVYNRQGCGSSTCEGVAILKRLDRNNEV
GCIMLGPSCTFATFQLVDEEIGLTLSIPIISAGSFGLSCDYKPKLSRTLPPARKIIDLFL
NFKTEVLGFKPKWEKFYVYKKQVNNATEDCFWYINALEAPSARFASQTRRVMVREKKDLR
SIMKTSNRHSNIIILCGGPEEISSIKDDVDQIHPDTLFILLDLYNPEYYVNETAHEWMQD
VLVVTLPQRNYSYNSNSSQNETINDYVAGYHDGALVFGQVLRDRLMSNKNSEDVDFNPFA
NVTIEGLGGPVVLDEHGDRDVNFSFIYTSMKTGKYETLLVFDSSQNRTIATHPNPALGWK
GQLPNDEPENPEDLGTQDVIVIVLGVSVVVVTAIALIFYRQNRTERLMQKKWSHISPHLI
GPLDEKEVSLKIDDDKRKDSTYFRQRGCYDKKPVILKELKQAEGDFTEDQKIELNTLLRI
DYYNLAKFYGTVKFEYGVFGVFELCQRGSLRYILSDRISYPDETFMDMEFKISVMYDIAK
GMSYLHSSSIPVHGRLKSTNCVVDNRMVVKITDFGCHTILMPGRDLWTAPEHLRKVDVSQ
KGDVYSYGIIAHEIVLRQTPFYTRSCFNTAEKLHRVQYPRGNGFFRPDLYFEGVSDREIE
LYMLIRSCWDEDPERRPDFKRIELTLGKIFSNLHNQATETYMDNLIRRLQMYSRTLECLV
EERTALYKAERDRADRLNFMLLPGPVVISLKETGRVEPELFEEVTIYFSDIVGFTTLCHY
STPMEVVDMLNEIYKNFDSILDHHDVYKVETIGDAYMVASGLPKRNGDRHAVDIAHMALD
LLSFVGTFELQHLPGIPLWIRIGVHSGPCAAGVVGNKMPRYCLFGDTVNTASRMESTGLP
LRIHASQSTINILRRTDCQFEFEKRGETYLKGKGKEMTYWLTGVTGRTYNLPTPPTAENF
QRLQQDLADMIVSSLEKHRAGREGFEKRKTLSTRIRWRDTNGSLRKDGPPEYFHLAVTDN
PSTFL
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcagctgggactgtttactgtacctgggagtgctgggagtgctgggagtgctg
ggagtggtggcgtctggccacaaaatgctggacgactgcttgacatcagaccgtaaatac
aaaatgaacgtcgttcttctggaggacaacacctacgagtggagtcggccatttgtgcag
agggccgtggagcacgctattgagaaggacaggcagaagaacgtcgacaatgacctggac
ctcgttttgacggctaactacaacgggttcaacaccaccgtgtacaacagacagggctgc
ggcagcagcacctgcgaaggagtggcaatactcaagaggctggatcgcaacaatgaagtc
ggctgcatcatgctggggccttcgtgtacttttgccaccttccagttagtggacgaggag
atcggcttgaccctgagcattcccatcatctctgctggcagcttcggcctctcctgcgac
tacaagcccaaactgtcgcgcaccttgcctccggcccgaaaaatcatcgatttgttcctg
aacttcaagaccgaggtgctgggatttaagcccaagtgggagaaattctacgtgtacaaa
aagcaagtgaacaacgcaaccgaagactgcttctggtacatcaatgcgctggaggcgccg
tcggcgaggttcgcgtcgcaaacacggagggtgatggtgcgggaaaagaaggacctgcgg
agcatcatgaagacttcaaatcgccacagcaacattattattttatgtggcggccctgaa
gaaatttcctcaataaaggacgatgtggaccagattcacccagacaccttgttcattctt
cttgatctttataaccctgaatattacgtcaacgaaacggcccacgagtggatgcaagac
gtcctggtcgtcactctgccgcagaggaactacagctacaactcaaactcgtcacaaaac
gagacgataaatgactacgtggccggatatcatgacggagctctggttttcggacaagtg
cttagagatcggttgatgagcaacaagaactctgaagacgtcgatttcaacccgtttgca
aacgtgactatcgagggtctaggaggacctgttgtgcttgatgagcacggagacagagac
gtgaacttctccttcatttacacgtcaatgaaaaccgggaagtatgaaactctgctagtg
tttgattcgtcacaaaacagaaccattgcaacgcacccgaacccggctctgggctggaaa
ggccaacttcctaatgatgaacccgaaaatccagaagatttgggcacacaggacgtgatc
gtgatcgttttgggtgtcagcgttgtcgtagtgaccgccatcgctctcatcttctacagg
cagaacaggacggagcgtctgatgcagaagaagtggtcacacatcagtccgcacctgatt
ggtcctctggatgagaaggaagtctctctgaagattgatgacgataagaggaaggacagc
acatacttcagacagcgaggctgctacgacaagaagccagtgatcctgaaagagctgaag
caggcagaaggagatttcaccgaggaccagaaaattgagctcaacactctgctccggatc
gattactacaacctggccaagttttacggcacagtgaagttcgagtacggcgtcttcggg
gtgtttgagctctgccagcggggatccctcaggtacatcctcagcgacaggatatcctac
ccagatgagaccttcatggacatggagtttaaaatatctgtcatgtacgacatcgcgaag
ggcatgtcgtacctgcactcgagtagcattccggtccacggacgcctcaagtccaccaac
tgcgtggtcgacaaccgcatggttgtcaagatcacagactttggctgccacaccatcctg
atgccaggcagagatctgtggacggctccagagcatctccgtaaagtcgacgtttcgcag
aaaggcgacgtctacagctacggcatcatagcacacgagatcgtcctgaggcaaaccccg
ttctacacccgctcctgcttcaacaccgcagagaaactgcacagagttcagtatcccaga
ggaaacggcttcttcagaccggacctctactttgaaggagtatcagacagagaaattgag
ctctacatgctgataaggagctgctgggatgaagaccctgagcgaaggccagacttcaag
aggatagagttaacgctgggaaagattttcagtaacttgcacaaccaggccactgagacg
tacatggacaacctgatccgccgcctgcagatgtactccaggactctggagtgtttggtg
gaggagaggacggctctgtacaaagccgagagggacagagcggaccgcctcaacttcatg
ctgctgccgggtcccgtggtgatctcgctaaaggagacaggaagagtggagcccgagctg
tttgaggaggtcaccatctatttcagcgacatagtgggcttcaccaccctgtgccactac
agcacccccatggaggtggtggacatgctgaacgagatctacaagaactttgacagcatc
ctggatcaccatgatgtctacaaggttgagacgataggagatgcctatatggttgcgtca
gggttacccaagcgaaatggcgacagacatgcggtggacatcgcccacatggccctcgac
ctcctgtcgtttgttgggacttttgagttgcagcacctgccagggattcctctgtggatt
cgcattggagtgcattcaggtccgtgtgccgccggcgtggtcggaaacaagatgcctcgc
tactgtctctttggagacacggtgaacacggcgtctcgcatggagtccacaggcctgcct
ctgaggattcatgcgagccagtccacaatcaatatcctgcggaggacagactgtcagttt
gagtttgaaaaaagaggagagacgtacctaaagggtaaagggaaggagatgacctactgg
ctaacaggtgtaacaggaagaacctacaacctgcccacaccaccgacagcggagaacttc
cagaggctccagcaggacctggcagacatgatcgtgtccagcctggagaagcaccgagcc
ggaagggagggcttcgaaaagaggaagaccttgtccaccagaatccgctggagagacacc
aacggcagcctgaggaaggacggccctccggagtacttccacctggctgtcactgacaat
cccagcacgttcctgtga

DBGET integrated database retrieval system